KEGG   Homo sapiens (human): 9076Help
Entry
9076              CDS       T01001                                 

Gene name
CLDN1, CLD1, ILVASC, SEMP1
Definition
claudin 1
Orthology
K06087  
claudin
Organism
hsa  Homo sapiens (human)
Pathway
Cell adhesion molecules (CAMs)
Tight junction
Leukocyte transendothelial migration
Pathogenic Escherichia coli infection
Hepatitis C
Disease
H00742  
Neonatal ichthyosis-sclerosing cholangitis (NISCH) syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    9076 (CLDN1)
 Cellular Processes
  Cell communication
   04530 Tight junction
    9076 (CLDN1)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    9076 (CLDN1)
 Human Diseases
  Infectious diseases
   05130 Pathogenic Escherichia coli infection
    9076 (CLDN1)
   05160 Hepatitis C
    9076 (CLDN1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   9076 (CLDN1)
  Exosomal proteins of colorectal cancer cells
   9076 (CLDN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3q28-q29
AA seq 211 aa AA seqDB search
MANAGLQLLGFILAFLGWIGAIVSTALPQWRIYSYAGDNIVTAQAMYEGLWMSCVSQSTG
QIQCKVFDSLLNLSSTLQATRALMVVGILLGVIAIFVATVGMKCMKCLEDDEVQKMRMAV
IGGAIFLLAGLAILVATAWYGNRIVQEFYDPMTPVNARYEFGQALFTGWAAASLCLLGGA
LLCCSCPRKTTSYPTPRPYPKPAPSSGKDYV
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atggccaacgcggggctgcagctgttgggcttcattctcgccttcctgggatggatcggc
gccatcgtcagcactgccctgccccagtggaggatttactcctatgccggcgacaacatc
gtgaccgcccaggccatgtacgaggggctgtggatgtcctgcgtgtcgcagagcaccggg
cagatccagtgcaaagtctttgactccttgctgaatctgagcagcacattgcaagcaacc
cgtgccttgatggtggttggcatcctcctgggagtgatagcaatctttgtggccaccgtt
ggcatgaagtgtatgaagtgcttggaagacgatgaggtgcagaagatgaggatggctgtc
attgggggtgcgatatttcttcttgcaggtctggctattttagttgccacagcatggtat
ggcaatagaatcgttcaagaattctatgaccctatgaccccagtcaatgccaggtacgaa
tttggtcaggctctcttcactggctgggctgctgcttctctctgccttctgggaggtgcc
ctactttgctgttcctgtccccgaaaaacaacctcttacccaacaccaaggccctatcca
aaacctgcaccttccagcgggaaagactacgtgtga

DBGET integrated database retrieval system