KEGG   Homo sapiens (human): 913Help
Entry
913               CDS       T01001                                 

Gene name
CD1E, CD1A, R2
Definition
(RefSeq) CD1e molecule
  KO
K06448  
T-cell surface glycoprotein CD1
Organism
hsa  Homo sapiens (human)
Pathway
Tight junction
Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cellular community - eukaryotes
   04530 Tight junction
    913 (CD1E)
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    913 (CD1E)
Cellular antigens [BR:hsa04090]
 Proteins
  913 (CD1E)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P15812(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
1q23.1
AA seq 388 aa AA seqDB search
MLLLFLLFEGLCCPGENTAAPQALQSYHLAAEEQLSFRMLQTSSFANHSWAHSEGSGWLG
DLQTHGWDTVLGTIRFLKPWSHGNFSKQELKNLQSLFQLYFHSFIQIVQASAGQFQLEYP
FEIQILAGCRMNAPQIFLNMAYQGSDFLSFQGISWEPSPGAGIRAQNICKVLNRYLDIKE
ILQSLLGHTCPRFLAGLMEAGESELKRKVKPEAWLSCGPSPGPGRLQLVCHVSGFYPKPV
WVMWMRGEQEQRGTQRGDVLPNADETWYLRATLDVAAGEAAGLSCRVKHSSLGGHDLIIH
WGGYSIFLILICLTVIVTLVILVVVDSRLKKQSSNKNILSPHTPSPVFLMGANTQDTKNS
RHQFCLAQVSWIKNRVLKKWKTRLNQLW
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgctgctcctgttcctcctcttcgagggtctctgctgtcctggggaaaatacagcagct
ccccaggctctacaatcctatcatctagcagcagaggagcagctgtccttccgcatgctc
caaacttcctcctttgccaaccacagctgggcacacagtgagggctcaggatggctgggt
gacctgcagactcatggctgggacactgtcttgggcaccatccgctttctgaagccctgg
tcccatggaaacttcagcaagcaggagctgaaaaacttacagtcactgttccagttatac
ttccatagttttatccagatagtgcaagcttctgctggtcaatttcagcttgaatacccc
ttcgagatccagatattagctggctgtagaatgaatgccccacaaatcttcttaaatatg
gcatatcaagggtcagatttcctgagtttccaaggaatttcctgggagccatctccagga
gcagggatccgggcccagaacatctgtaaagtgctcaatcgctacctagatattaaggaa
atactgcaaagccttcttggtcacacctgccctcgatttctagcggggctcatggaagca
ggggagtcagaactgaaacggaaagtgaagccagaggcctggctgtcctgtggccccagt
cctggccctggccgtctgcagcttgtgtgccatgtctcaggattctacccaaagcccgtg
tgggtgatgtggatgcggggtgagcaggagcagcggggcactcagcgaggggacgtcctg
cctaatgctgacgagacatggtatctccgagcaaccctggatgtggcggctggggaggca
gctggcctgtcctgtcgggtgaaacacagcagtctagggggccatgatctaatcatccat
tggggtggatattccatctttctcatcctgatctgtttgactgtgatagttaccctggtc
atattggttgtagttgactcacggttaaaaaaacagagttcaaataagaacattctttct
ccccacacacccagccctgtctttctcatgggagccaacactcaggacaccaagaattca
agacatcagttctgcttggcacaagtatcgtggatcaaaaacagagtattgaagaagtgg
aagacacgcctaaaccaactctggtga

DBGET integrated database retrieval system