KEGG   Homo sapiens (human): 9131Help
Entry
9131              CDS       T01001                                 

Gene name
AIFM1, AIF, CMT2D, CMTX4, COWCK, COXPD6, DFNX5, NADMR, NAMSD, PDCD8
Definition
(RefSeq) apoptosis inducing factor, mitochondria associated 1
  KO
K04727  
programmed cell death 8 (apoptosis-inducing factor) [EC:1.-.-.-]
Organism
hsa  Homo sapiens (human)
Pathway
Apoptosis
Disease
H00891  
Combined oxidative phosphorylation deficiency (COXPD)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    9131 (AIFM1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.-  
   1.-.-  
    1.-.-.-  
     9131 (AIFM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
Xq26.1
AA seq 613 aa AA seqDB search
MFRCGGLAAGALKQKLVPLVRTVCVRSPRQRNRLPGNLFQRWHVPLELQMTRQMASSGAS
GGKIDNSVLVLIVGLSTVGAGAYAYKTMKEDEKRYNERISGLGLTPEQKQKKAALSASEG
EEVPQDKAPSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELW
FSDDPNVTKTLRFKQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRD
NMVKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREV
KSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREG
VKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGG
FRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQS
MFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASE
ITIPPSTPAVPQAPVQGEDYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHED
LNEVAKLFNIHED
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atgttccggtgtggaggcctggcggcgggtgctttgaagcagaagctggtgcccttggtg
cggaccgtgtgcgtccgaagcccgaggcagaggaaccggctcccaggcaacttgttccag
cgatggcatgttcctctagaactccagatgacaagacaaatggctagctctggtgcatca
gggggcaaaatcgataattctgtgttagtccttattgtgggcttatcaacagtaggagct
ggtgcctatgcctacaagactatgaaagaggatgaaaaaagatacaatgaaagaatttca
gggttagggctgacaccagaacagaaacagaaaaaggccgcgttatctgcttcagaagga
gaggaagttcctcaagacaaggcgccaagtcatgttcctttcctgctaattggtggaggc
acagctgcttttgctgcagccagatccatccgggctcgggatcctggggccagggtactg
attgtatctgaagatcctgagctgccgtacatgcgacctcctctttcaaaagaactgtgg
ttttcagatgacccaaatgtcacaaagacactgcgattcaaacagtggaatggaaaagag
agaagcatatatttccagccaccttctttctatgtctctgctcaggacctgcctcatatt
gagaatggtggtgtggctgtcctcactgggaagaaggtagtacagctggatgtgagagac
aacatggtgaaacttaatgatggctctcaaataacctatgaaaagtgcttgattgcaaca
ggaggtactccaagaagtctgtctgccattgatagggctggagcagaggtgaagagtaga
acaacgcttttcagaaagattggagactttagaagcttggagaagatttcacgggaagtc
aaatcaattacgattatcggtgggggcttccttggtagcgaactggcctgtgctcttggc
agaaaggctcgagccttgggcacagaagtgattcaactcttccccgagaaaggaaatatg
ggaaagatcctccccgaatacctcagcaactggaccatggaaaaagtcagacgagagggg
gttaaggtgatgcccaatgctattgtgcaatccgttggagtcagcagtggcaagttactt
atcaagctgaaagacggcaggaaggtagaaactgaccacatagtggcagctgtgggcctg
gagcccaatgttgagttggccaagactggtggcctggaaatagactcagattttggtggc
ttccgggtaaatgcagagctacaagcacgctctaacatctgggtggcaggagatgctgca
tgcttctacgatataaagttgggaaggaggcgggtagagcaccatgatcacgctgttgtg
agtggaagattggctggagaaaatatgactggagctgctaagccgtactggcatcagtca
atgttctggagtgatttgggccccgatgttggctatgaagctattggtcttgtggacagt
agtttgcccacagttggtgtttttgcaaaagcaactgcacaagacaaccccaaatctgcc
acagagcagtcaggaactggtatccgatcagagagtgagacagagtccgaggcctcagaa
attactattcctcccagcaccccggcagttccacaggctcccgtccagggggaggactac
ggcaaaggtgtcatcttctacctcagggacaaagtggtcgtggggattgtgctatggaac
atctttaaccgaatgccaatagcaaggaagatcattaaggacggtgagcagcatgaagat
ctcaatgaagtagccaaactattcaacattcatgaagactga

DBGET integrated database retrieval system