KEGG   Homo sapiens (human): 9133Help
Entry
9133              CDS       T01001                                 

Gene name
CCNB2, HsT17299
Definition
cyclin B2
Orthology
K05868  
cyclin B
Organism
hsa  Homo sapiens (human)
Pathway
FoxO signaling pathway
Cell cycle
Oocyte meiosis
p53 signaling pathway
Progesterone-mediated oocyte maturation
HTLV-I infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    9133 (CCNB2)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    9133 (CCNB2)
   04114 Oocyte meiosis
    9133 (CCNB2)
   04115 p53 signaling pathway
    9133 (CCNB2)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    9133 (CCNB2)
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    9133 (CCNB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
15q22.2
AA seq 398 aa AA seqDB search
MALLRRPTVSSDLENIDTGVNSKVKSHVTIRRTVLEEIGNRVTTRAAQVAKKAQNTKVPV
QPTKTTNVNKQLKPTASVKPVQMEKLAPKGPSPTPEDVSMKEENLCQAFSDALLCKIEDI
DNEDWENPQLCSDYVKDIYQYLRQLEVLQSINPHFLDGRDINGRMRAILVDWLVQVHSKF
RLLQETLYMCVGIMDRFLQVQPVSRKKLQLVGITALLLASKYEEMFSPNIEDFVYITDNA
YTSSQIREMETLILKELKFELGRPLPLHFLRRASKAGEVDVEQHTLAKYLMELTLIDYDM
VHYHPSKVAAAASCLSQKVLGQGKWNLKQQYYTGYTENEVLEVMQHMAKNVVKVNENLTK
FIAIKNKYASSKLLKISMIPQLNSKAVKDLASPLIGRS
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgctccgacgcccgacggtgtccagtgatttggagaatattgacacaggagtt
aattctaaagttaagagtcatgtgactattaggcgaactgttttagaagaaattggaaat
agagttacaaccagagcagcacaagtagctaagaaagctcagaacaccaaagttccagtt
caacccaccaaaacaacaaatgtcaacaaacaactgaaacctactgcttctgtcaaacca
gtacagatggaaaagttggctccaaagggtccttctcccacacctgaggatgtctccatg
aaggaagagaatctctgccaagctttttctgatgccttgctctgcaaaatcgaggacatt
gataacgaagattgggagaaccctcagctctgcagtgactacgttaaggatatctatcag
tatctcaggcagctggaggttttgcagtccataaacccacatttcttagatggaagagat
ataaatggacgcatgcgtgccatcctagtggattggctggtacaagtccactccaagttt
aggcttctgcaggagactctgtacatgtgcgttggcattatggatcgatttttacaggtt
cagccagtttcccggaagaagcttcaattagttgggattactgctctgctcttggcttcc
aagtatgaggagatgttttctccaaatattgaagactttgtttacatcacagacaatgct
tataccagttcccaaatccgagaaatggaaactctaattttgaaagaattgaaatttgag
ttgggtcgacccttgccactacacttcttaaggcgagcatcaaaagccggggaggttgat
gttgaacagcacactttagccaagtatttgatggagctgactctcatcgactatgatatg
gtgcattatcatccttctaaggtagcagcagctgcttcctgcttgtctcagaaggttcta
ggacaaggaaaatggaacttaaagcagcagtattacacaggatacacagagaatgaagta
ttggaagtcatgcagcacatggccaagaatgtggtgaaagtaaatgaaaacttaactaaa
ttcatcgccatcaagaataagtatgcaagcagcaaactcctgaagatcagcatgatccct
cagctgaactcaaaagccgtcaaagaccttgcctccccactgataggaaggtcctag

DBGET integrated database retrieval system