KEGG   Homo sapiens (human): 9138Help
Entry
9138              CDS       T01001                                 

Gene name
ARHGEF1, GEF1, LBCL2, LSC, P115-RHOGEF, SUB1.5
Definition
Rho guanine nucleotide exchange factor (GEF) 1
Orthology
K12330  
Rho guanine nucleotide exchange factor 1
Organism
hsa  Homo sapiens (human)
Pathway
Vascular smooth muscle contraction
Regulation of actin cytoskeleton
Proteoglycans in cancer
Class
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:hsa04810]
Organismal Systems; Circulatory system; Vascular smooth muscle contraction [PATH:hsa04270]
Human Diseases; Cancers; Proteoglycans in cancer [PATH:hsa05205]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19q13.13
AA seq 912 aa AA seqDB search
MEDFARGAASPGPSRPGLVPVSIIGAEDEDFENELETNSEEQNSQFQSLEQVKRRPAHLM
ALLQHVALQFEPGPLLCCLHADMLGSLGPKEAKKAFLDFYHSFLEKTAVLRVPVPPNVAF
ELDRTRADLISEDVQRRFVQEVVQSQQVAVGRQLEDFRSKRLMGMTPWEQELAQLEAWVG
RDRASYEARERHVAERLLMHLEEMQHTISTDEEKSAAVVNAIGLYMRHLGVRTKSGDKKS
GRNFFRKKVMGNRRSDEPAKTKKGLSSILDAARWNRGEPQVPDFRHLKAEVDAEKPGATD
RKGGVGMPSRDRNIGAPGQDTPGVSLHPLSLDSPDREPGADAPLELGDSSPQGPMSLESL
APPESTDEGAETESPEPGDEGEPGRSGLELEPEEPPGWRELVPPDTLHSLPKSQVKRQEV
ISELLVTEAAHVRMLRVLHDLFFQPMAECLFFPLEELQNIFPSLDELIEVHSLFLDRLMK
RRQESGYLIEEIGDVLLARFDGAEGSWFQKISSRFCSRQSFALEQLKAKQRKDPRFCAFV
QEAESRPRCRRLQLKDMIPTEMQRLTKYPLLLQSIGQNTEEPTEREKVELAAECCREILH
HVNQAVRDMEDLLRLKDYQRRLDLSHLRQSSDPMLSEFKNLDITKKKLVHEGPLTWRVTK
DKAVEVHVLLLDDLLLLLQRQDERLLLKSHSRTLTPTPDGKTMLRPVLRLTSAMTREVAT
DHKAFYVLFTWDQEAQIYELVAQTVSERKNWCALITETAGSLKVPAPASRPKPRPSPSST
REPLLSSSENGNGGRETSPADARTERILSDLLPFCRPGPEGQLAATALRKVLSLKQLLFP
AEEDNGAGPPRDGDGVPGGGPLSPARTQEIQENLLSLEETMKQLEELEEEFCRLRPLLSQ
LGGNSVPQPGCT
NT seq 2739 nt NT seq  +upstreamnt  +downstreamnt
atggaagacttcgcccgaggggcggcctccccaggcccctcccggcctggcctggttccc
gtcagcatcatcggggctgaggatgaggattttgagaacgagctggagacaaactcagaa
gagcaaaacagccagttccagagcctggagcaggtgaagcggcgcccagcccacctcatg
gccctcctgcagcacgtggccctgcagtttgagccaggacccctgctttgctgtctgcat
gccgacatgctgggctcactgggccccaaggaggccaagaaggccttcctggacttctac
cacagcttcctggagaagacagcggttctccgggtgccggtccctcccaacgtcgccttt
gaacttgaccgcactagggctgacctcatctccgaggatgtccagcggcggttcgtgcag
gaggtggtgcaaagccagcaggtagccgtgggccggcagctggaggacttccgttccaag
cggctcatgggcatgacgccctgggagcaggagctggcccagctggaggcttgggttggg
cgggaccgagccagctacgaggcccgggagcggcacgtggcggagcggctgctcatgcac
ctggaggagatgcaacataccatctctaccgacgaagaaaagagtgctgccgtggtcaac
gccattggcctgtacatgcgccaccttggggtgcggaccaagagtggagacaagaagtcg
gggaggaacttcttccggaaaaaggtgatggggaaccggcggtcggacgagcctgccaag
accaagaaggggctgagcagcatcctggatgccgcccgctggaaccggggagagccccag
gttccagattttcgacacctcaaagcagaggttgatgccgagaagccaggtgctacagac
cggaagggaggcgtggggatgccctctcgggaccggaatatcggggctcctgggcaggac
acccctggagtctctctgcaccctctgtccctggacagcccagaccgggaaccaggtgct
gacgcccccctggagctgggggactcatccccgcagggcccaatgagcctggagtccttg
gcgcccccagagagtaccgacgagggggccgaaaccgagagccccgagcctggagatgag
ggggagccggggcggtcgggactggagcttgaaccagaagagcctcccggctggcgggaa
ctcgtccccccagacaccctgcacagcctgcccaagagccaggtgaagcggcaggaggtc
atcagcgagctgctggtgacagaggcggcccacgtgcgcatgctgcgggtgctgcacgac
ctcttcttccagcccatggcagaatgcctgttcttccccttggaggagctgcagaacatc
ttccccagcctggacgagctcatcgaggtgcattccctgttcctcgatcgcctgatgaag
cggaggcaggagagtggctacctcatcgaggagatcggagacgtgctgctggcccggttt
gatggtgctgagggctcctggttccagaaaatctcctcccgcttctgcagccgccagtca
tttgccttagagcagctcaaagccaagcaacgcaaggaccctcggttctgtgccttcgtg
caggaagctgagagccgcccgcggtgccgccgcctgcagctgaaggacatgatccccacg
gagatgcagcggctgaccaagtaccccctgctcctgcagagcatcgggcagaacacagaa
gagcccacagaacgggagaaagtggagctggcagccgagtgctgccgggaaattctacac
cacgtcaaccaagccgtgcgtgacatggaggacctgctgaggctcaaggactatcagcgg
cgcctggacttgtcccaccttcggcagagcagcgaccctatgctgagcgagttcaagaac
ctggacatcaccaagaagaaattggtccacgagggcccactgacgtggcgggtgactaag
gacaaggcagtggaggtgcatgtgctgctgctggacgacctgctgctgctgctccagcgc
caggacgagcggctgctgctcaagtcccatagccggacactgacgcccacgcccgatggc
aagaccatgctgcggcccgtgctgcggctcacctccgccatgacccgcgaggtggccacc
gatcacaaagccttctacgtcctttttacctgggaccaggaggcccagatatacgagctg
gtggcacagactgtgtcggagcggaaaaactggtgtgctctcatcactgagactgccgga
tccctgaaagtccctgcccctgcctctcgccctaagccccggcccagcccgagcagcacc
cgagaacccctcctcagcagctctgagaacggcaatggtggccgagagacgtctccagct
gatgcccggaccgagagaatcctcagtgacctcctgcccttctgcagaccaggccccgag
ggccagctcgctgccacggcccttcggaaagtgctgtccctgaagcagcttctgtttccg
gcggaggaagacaatggggcggggcctcctcgagatggggatggggtcccagggggcggc
cccctgagcccagcacggacccaggaaatccaggagaacctgctcagcttggaggagacc
atgaagcagctggaggagttggaggaggaattttgccgcctgagacccctcctgtctcag
cttggggggaactctgtcccccagcctggctgcacttga

DBGET integrated database retrieval system