KEGG   Homo sapiens (human): 9138Help
Entry
9138              CDS       T01001                                 

Gene name
ARHGEF1, GEF1, LBCL2, LSC, P115-RHOGEF, SUB1.5
Definition
Rho guanine nucleotide exchange factor (GEF) 1
Orthology
K12330  
Rho guanine nucleotide exchange factor 1
Organism
hsa  Homo sapiens (human)
Pathway
Vascular smooth muscle contraction
Platelet activation
Regulation of actin cytoskeleton
Pathways in cancer
Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    9138 (ARHGEF1)
 Organismal Systems
  Immune system
   04611 Platelet activation
    9138 (ARHGEF1)
  Circulatory system
   04270 Vascular smooth muscle contraction
    9138 (ARHGEF1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    9138 (ARHGEF1)
   05205 Proteoglycans in cancer
    9138 (ARHGEF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19q13.13
AA seq 912 aa AA seqDB search
MEDFARGAASPGPSRPGLVPVSIIGAEDEDFENELETNSEEQNSQFQSLEQVKRRPAHLM
ALLQHVALQFEPGPLLCCLHADMLGSLGPKEAKKAFLDFYHSFLEKTAVLRVPVPPNVAF
ELDRTRADLISEDVQRRFVQEVVQSQQVAVGRQLEDFRSKRLMGMTPWEQELAQLEAWVG
RDRASYEARERHVAERLLMHLEEMQHTISTDEEKSAAVVNAIGLYMRHLGVRTKSGDKKS
GRNFFRKKVMGNRRSDEPAKTKKGLSSILDAARWNRGEPQVPDFRHLKAEVDAEKPGATD
RKGGVGMPSRDRNIGAPGQDTPGVSLHPLSLDSPDREPGADAPLELGDSSPQGPMSLESL
APPESTDEGAETESPEPGDEGEPGRSGLELEPEEPPGWRELVPPDTLHSLPKSQVKRQEV
ISELLVTEAAHVRMLRVLHDLFFQPMAECLFFPLEELQNIFPSLDELIEVHSLFLDRLMK
RRQESGYLIEEIGDVLLARFDGAEGSWFQKISSRFCSRQSFALEQLKAKQRKDPRFCAFV
QEAESRPRCRRLQLKDMIPTEMQRLTKYPLLLQSIGQNTEEPTEREKVELAAECCREILH
HVNQAVRDMEDLLRLKDYQRRLDLSHLRQSSDPMLSEFKNLDITKKKLVHEGPLTWRVTK
DKAVEVHVLLLDDLLLLLQRQDERLLLKSHSRTLTPTPDGKTMLRPVLRLTSAMTREVAT
DHKAFYVLFTWDQEAQIYELVAQTVSERKNWCALITETAGSLKVPAPASRPKPRPSPSST
REPLLSSSENGNGGRETSPADARTERILSDLLPFCRPGPEGQLAATALRKVLSLKQLLFP
AEEDNGAGPPRDGDGVPGGGPLSPARTQEIQENLLSLEETMKQLEELEEEFCRLRPLLSQ
LGGNSVPQPGCT
NT seq 2739 nt NT seq  +upstreamnt  +downstreamnt
atggaagacttcgcccgaggggcggcctccccaggcccctcccggcctggcctggttccc
gtcagcatcatcggggctgaggatgaggattttgagaacgagctggagacaaactcagaa
gagcaaaacagccagttccagagcctggagcaggtgaagcggcgcccagcccacctcatg
gccctcctgcagcacgtggccctgcagtttgagccaggacccctgctttgctgtctgcat
gccgacatgctgggctcactgggccccaaggaggccaagaaggccttcctggacttctac
cacagcttcctggagaagacagcggttctccgggtgccggtccctcccaacgtcgccttt
gaacttgaccgcactagggctgacctcatctccgaggatgtccagcggcggttcgtgcag
gaggtggtgcaaagccagcaggtagccgtgggccggcagctggaggacttccgttccaag
cggctcatgggcatgacgccctgggagcaggagctggcccagctggaggcttgggttggg
cgggaccgagccagctacgaggcccgggagcggcacgtggcggagcggctgctcatgcac
ctggaggagatgcaacataccatctctaccgacgaagaaaagagtgctgccgtggtcaac
gccattggcctgtacatgcgccaccttggggtgcggaccaagagtggagacaagaagtcg
gggaggaacttcttccggaaaaaggtgatggggaaccggcggtcggacgagcctgccaag
accaagaaggggctgagcagcatcctggatgccgcccgctggaaccggggagagccccag
gttccagattttcgacacctcaaagcagaggttgatgccgagaagccaggtgctacagac
cggaagggaggcgtggggatgccctctcgggaccggaatatcggggctcctgggcaggac
acccctggagtctctctgcaccctctgtccctggacagcccagaccgggaaccaggtgct
gacgcccccctggagctgggggactcatccccgcagggcccaatgagcctggagtccttg
gcgcccccagagagtaccgacgagggggccgaaaccgagagccccgagcctggagatgag
ggggagccggggcggtcgggactggagcttgaaccagaagagcctcccggctggcgggaa
ctcgtccccccagacaccctgcacagcctgcccaagagccaggtgaagcggcaggaggtc
atcagcgagctgctggtgacagaggcggcccacgtgcgcatgctgcgggtgctgcacgac
ctcttcttccagcccatggcagaatgcctgttcttccccttggaggagctgcagaacatc
ttccccagcctggacgagctcatcgaggtgcattccctgttcctcgatcgcctgatgaag
cggaggcaggagagtggctacctcatcgaggagatcggagacgtgctgctggcccggttt
gatggtgctgagggctcctggttccagaaaatctcctcccgcttctgcagccgccagtca
tttgccttagagcagctcaaagccaagcaacgcaaggaccctcggttctgtgccttcgtg
caggaagctgagagccgcccgcggtgccgccgcctgcagctgaaggacatgatccccacg
gagatgcagcggctgaccaagtaccccctgctcctgcagagcatcgggcagaacacagaa
gagcccacagaacgggagaaagtggagctggcagccgagtgctgccgggaaattctacac
cacgtcaaccaagccgtgcgtgacatggaggacctgctgaggctcaaggactatcagcgg
cgcctggacttgtcccaccttcggcagagcagcgaccctatgctgagcgagttcaagaac
ctggacatcaccaagaagaaattggtccacgagggcccactgacgtggcgggtgactaag
gacaaggcagtggaggtgcatgtgctgctgctggacgacctgctgctgctgctccagcgc
caggacgagcggctgctgctcaagtcccatagccggacactgacgcccacgcccgatggc
aagaccatgctgcggcccgtgctgcggctcacctccgccatgacccgcgaggtggccacc
gatcacaaagccttctacgtcctttttacctgggaccaggaggcccagatatacgagctg
gtggcacagactgtgtcggagcggaaaaactggtgtgctctcatcactgagactgccgga
tccctgaaagtccctgcccctgcctctcgccctaagccccggcccagcccgagcagcacc
cgagaacccctcctcagcagctctgagaacggcaatggtggccgagagacgtctccagct
gatgcccggaccgagagaatcctcagtgacctcctgcccttctgcagaccaggccccgag
ggccagctcgctgccacggcccttcggaaagtgctgtccctgaagcagcttctgtttccg
gcggaggaagacaatggggcggggcctcctcgagatggggatggggtcccagggggcggc
cccctgagcccagcacggacccaggaaatccaggagaacctgctcagcttggaggagacc
atgaagcagctggaggagttggaggaggaattttgccgcctgagacccctcctgtctcag
cttggggggaactctgtcccccagcctggctgcacttga

DBGET integrated database retrieval system