KEGG   Homo sapiens (human): 914Help
Entry
914               CDS       T01001                                 

Gene name
CD2, LFA-2, SRBC, T11
Definition
CD2 molecule
Orthology
K06449  
CD2 antigen
Organism
hsa  Homo sapiens (human)
Pathway
Cell adhesion molecules (CAMs)
Hematopoietic cell lineage
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    914 (CD2)
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    914 (CD2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   914 (CD2)
Cellular antigens [BR:hsa04090]
 Proteins
  914 (CD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p13.1
AA seq 351 aa AA seqDB search
MSFPCKFVASFLLIFNVSSKGAVSKEITNALETWGALGQDINLDIPSFQMSDDIDDIKWE
KTSDKKKIAQFRKEKETFKEKDTYKLFKNGTLKIKHLKTDDQDIYKVSIYDTKGKNVLEK
IFDLKIQERVSKPKISWTCINTTLTCEVMNGTDPELNLYQDGKHLKLSQRVITHKWTTSL
SAKFKCTAGNKVSKESSVEPVSCPEKGLDIYLIIGICGGGSLLMVFVALLVFYITKRKKQ
RSRRNDEELETRAHRVATEERGRKPHQIPASTPQNPATSQHPPPPPGHRSQAPSHRPPPP
GHRVQHQPQKRPPAPSGTQVHQQKGPPLPRPRVQPKPPHGAAENSLSPSSN
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgagctttccatgtaaatttgtagccagcttccttctgattttcaatgtttcttccaaa
ggtgcagtctccaaagagattacgaatgccttggaaacctggggtgccttgggtcaggac
atcaacttggacattcctagttttcaaatgagtgatgatattgacgatataaaatgggaa
aaaacttcagacaagaaaaagattgcacaattcagaaaagagaaagagactttcaaggaa
aaagatacatataagctatttaaaaatggaactctgaaaattaagcatctgaagaccgat
gatcaggatatctacaaggtatcaatatatgatacaaaaggaaaaaatgtgttggaaaaa
atatttgatttgaagattcaagagagggtctcaaaaccaaagatctcctggacttgtatc
aacacaaccctgacctgtgaggtaatgaatggaactgaccccgaattaaacctgtatcaa
gatgggaaacatctaaaactttctcagagggtcatcacacacaagtggaccaccagcctg
agtgcaaaattcaagtgcacagcagggaacaaagtcagcaaggaatccagtgtcgagcct
gtcagctgtccagagaaaggtctggacatctatctcatcattggcatatgtggaggaggc
agcctcttgatggtctttgtggcactgctcgttttctatatcaccaaaaggaaaaaacag
aggagtcggagaaatgatgaggagctggagacaagagcccacagagtagctactgaagaa
aggggccggaagccccaccaaattccagcttcaacccctcagaatccagcaacttcccaa
catcctcctccaccacctggtcatcgttcccaggcacctagtcatcgtcccccgcctcct
ggacaccgtgttcagcaccagcctcagaagaggcctcctgctccgtcgggcacacaagtt
caccagcagaaaggcccgcccctccccagacctcgagttcagccaaaacctccccatggg
gcagcagaaaactcattgtccccttcctctaattaa

DBGET integrated database retrieval system