KEGG   Homo sapiens (human): 914Help
Entry
914               CDS       T01001                                 

Gene name
CD2, LFA-2, SRBC, T11
Definition
CD2 molecule
Orthology
K06449  
CD2 antigen
Organism
hsa  Homo sapiens (human)
Pathway
Cell adhesion molecules (CAMs)
Hematopoietic cell lineage
Drug target
Other: 
Class
Environmental Information Processing; Signaling molecules and interaction; Cell adhesion molecules (CAMs) [PATH:hsa04514]
Organismal Systems; Immune system; Hematopoietic cell lineage [PATH:hsa04640]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p13.1
AA seq 351 aa AA seqDB search
MSFPCKFVASFLLIFNVSSKGAVSKEITNALETWGALGQDINLDIPSFQMSDDIDDIKWE
KTSDKKKIAQFRKEKETFKEKDTYKLFKNGTLKIKHLKTDDQDIYKVSIYDTKGKNVLEK
IFDLKIQERVSKPKISWTCINTTLTCEVMNGTDPELNLYQDGKHLKLSQRVITHKWTTSL
SAKFKCTAGNKVSKESSVEPVSCPEKGLDIYLIIGICGGGSLLMVFVALLVFYITKRKKQ
RSRRNDEELETRAHRVATEERGRKPHQIPASTPQNPATSQHPPPPPGHRSQAPSHRPPPP
GHRVQHQPQKRPPAPSGTQVHQQKGPPLPRPRVQPKPPHGAAENSLSPSSN
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgagctttccatgtaaatttgtagccagcttccttctgattttcaatgtttcttccaaa
ggtgcagtctccaaagagattacgaatgccttggaaacctggggtgccttgggtcaggac
atcaacttggacattcctagttttcaaatgagtgatgatattgacgatataaaatgggaa
aaaacttcagacaagaaaaagattgcacaattcagaaaagagaaagagactttcaaggaa
aaagatacatataagctatttaaaaatggaactctgaaaattaagcatctgaagaccgat
gatcaggatatctacaaggtatcaatatatgatacaaaaggaaaaaatgtgttggaaaaa
atatttgatttgaagattcaagagagggtctcaaaaccaaagatctcctggacttgtatc
aacacaaccctgacctgtgaggtaatgaatggaactgaccccgaattaaacctgtatcaa
gatgggaaacatctaaaactttctcagagggtcatcacacacaagtggaccaccagcctg
agtgcaaaattcaagtgcacagcagggaacaaagtcagcaaggaatccagtgtcgagcct
gtcagctgtccagagaaaggtctggacatctatctcatcattggcatatgtggaggaggc
agcctcttgatggtctttgtggcactgctcgttttctatatcaccaaaaggaaaaaacag
aggagtcggagaaatgatgaggagctggagacaagagcccacagagtagctactgaagaa
aggggccggaagccccaccaaattccagcttcaacccctcagaatccagcaacttcccaa
catcctcctccaccacctggtcatcgttcccaggcacctagtcatcgtcccccgcctcct
ggacaccgtgttcagcaccagcctcagaagaggcctcctgctccgtcgggcacacaagtt
caccagcagaaaggcccgcccctccccagacctcgagttcagccaaaacctccccatggg
gcagcagaaaactcattgtccccttcctctaattaa

DBGET integrated database retrieval system