KEGG   Homo sapiens (human): 914Help
Entry
914               CDS       T01001                                 

Gene name
CD2, LFA-2, SRBC, T11
Definition
(RefSeq) CD2 molecule
  KO
K06449  T-cell surface glycoprotein CD2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules (CAMs)
hsa04640  Hematopoietic cell lineage
Drug target
Antithymocyte immunoglobulin (rabbit): D09190
Siplizumab: D05847
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    914 (CD2)
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    914 (CD2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   914 (CD2)
CD molecules [BR:hsa04090]
 Proteins
  914 (CD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: C2-set V-set Ig_2 I-set EphA2_TM DUF1191 SARAF YjgP_YjgQ
Motif
Other DBs
NCBI-GeneID: 914
NCBI-ProteinID: NP_001758
OMIM: 186990
HGNC: 1639
Ensembl: ENSG00000116824
Vega: OTTHUMG00000022750
Pharos: P06729(Tclin)
UniProt: P06729 Q53F96
Structure
PDB: 

Jmol
Position
1p13.1
AA seq 351 aa AA seqDB search
MSFPCKFVASFLLIFNVSSKGAVSKEITNALETWGALGQDINLDIPSFQMSDDIDDIKWE
KTSDKKKIAQFRKEKETFKEKDTYKLFKNGTLKIKHLKTDDQDIYKVSIYDTKGKNVLEK
IFDLKIQERVSKPKISWTCINTTLTCEVMNGTDPELNLYQDGKHLKLSQRVITHKWTTSL
SAKFKCTAGNKVSKESSVEPVSCPEKGLDIYLIIGICGGGSLLMVFVALLVFYITKRKKQ
RSRRNDEELETRAHRVATEERGRKPHQIPASTPQNPATSQHPPPPPGHRSQAPSHRPPPP
GHRVQHQPQKRPPAPSGTQVHQQKGPPLPRPRVQPKPPHGAAENSLSPSSN
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgagctttccatgtaaatttgtagccagcttccttctgattttcaatgtttcttccaaa
ggtgcagtctccaaagagattacgaatgccttggaaacctggggtgccttgggtcaggac
atcaacttggacattcctagttttcaaatgagtgatgatattgacgatataaaatgggaa
aaaacttcagacaagaaaaagattgcacaattcagaaaagagaaagagactttcaaggaa
aaagatacatataagctatttaaaaatggaactctgaaaattaagcatctgaagaccgat
gatcaggatatctacaaggtatcaatatatgatacaaaaggaaaaaatgtgttggaaaaa
atatttgatttgaagattcaagagagggtctcaaaaccaaagatctcctggacttgtatc
aacacaaccctgacctgtgaggtaatgaatggaactgaccccgaattaaacctgtatcaa
gatgggaaacatctaaaactttctcagagggtcatcacacacaagtggaccaccagcctg
agtgcaaaattcaagtgcacagcagggaacaaagtcagcaaggaatccagtgtcgagcct
gtcagctgtccagagaaaggtctggacatctatctcatcattggcatatgtggaggaggc
agcctcttgatggtctttgtggcactgctcgttttctatatcaccaaaaggaaaaaacag
aggagtcggagaaatgatgaggagctggagacaagagcccacagagtagctactgaagaa
aggggccggaagccccaccaaattccagcttcaacccctcagaatccagcaacttcccaa
catcctcctccaccacctggtcatcgttcccaggcacctagtcatcgtcccccgcctcct
ggacaccgtgttcagcaccagcctcagaagaggcctcctgctccgtcgggcacacaagtt
caccagcagaaaggcccgcccctccccagacctcgagttcagccaaaacctccccatggg
gcagcagaaaactcattgtccccttcctctaattaa

DBGET integrated database retrieval system