KEGG   Homo sapiens (human): 9146Help
Entry
9146              CDS       T01001                                 

Gene name
HGS, HRS
Definition
(RefSeq) hepatocyte growth factor-regulated tyrosine kinase substrate
  KO
K12182  
hepatocyte growth factor-regulated tyrosine kinase substrate
Organism
hsa  Homo sapiens (human)
Pathway
Endocytosis
Phagosome
Module
ESCRT-0 complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    9146 (HGS)
   04145 Phagosome
    9146 (HGS)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-0 complex
    9146 (HGS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17q25
AA seq 777 aa AA seqDB search
MGRGSGTFERLLDKATSQLLLETDWESILQICDLIRQGDTQAKYAVNSIKKKVNDKNPHV
ALYALEVMESVVKNCGQTVHDEVANKQTMEELKDLLKRQVEVNVRNKILYLIQAWAHAFR
NEPKYKVVQDTYQIMKVEGHVFPEFKESDAMFAAERAPDWVDAEECHRCRVQFGVMTRKH
HCRACGQIFCGKCSSKYSTIPKFGIEKEVRVCEPCYEQLNRKAEGKATSTTELPPEYLTS
PLSQQSQLPPKRDETALQEEEELQLALALSQSEAEEKERLRQKSTYTSYPKAEPMPSASS
APPASSLYSSPVNSSAPLAEDIDPELARYLNRNYWEKKQEEARKSPTPSAPVPLTEPAAQ
PGEGHAAPTNVVENPLPETDSQPIPPSGGPFSEPQFHNGESEESHEQFLKALQNAVTTFV
NRMKSNHMRGRSITNDSAVLSLFQSINGMHPQLLELLNQLDERRLYYEGLQDKLAQIRDA
RGALSALREEHREKLRRAAEEAERQRQIQLAQKLEIMRQKKQEYLEVQRQLAIQRLQEQE
KERQMRLEQQKQTVQMRAQMPAFPLPYAQLQAMPAAGGVLYQPSGPASFPSTFSPAGSVE
GSPMHGVYMSQPAPAAGPYPSMPSTAADPSMVSAYMYPAGATGAQAAPQAQAGPTASPAY
SSYQPTPTAGYQNVASQAPQSLPAISQPPQSSTMGYMGSQSVSMGYQPYNMQNLMTTLPS
QDASLPPQQPYIAGQQPMYQQMAPSGGPPQQQPPVAQQPQAQGPPAQGSEAQLISFD
NT seq 2334 nt NT seq  +upstreamnt  +downstreamnt
atggggcgaggcagcggcaccttcgagcgtctcctagacaaggcgaccagccagctcctg
ttggagacagattgggagtccattttgcagatctgcgacctgatccgccaaggggacaca
caagcaaaatatgctgtgaattccatcaagaagaaagtcaacgacaagaacccacacgtc
gccttgtatgccctggaggtcatggaatctgtggtaaagaactgtggccagacagttcat
gatgaggtggccaacaagcagaccatggaggagctgaaggacctgctgaagagacaagtg
gaggtaaacgtccgtaacaagatcctgtacctgatccaggcctgggcgcatgccttccgg
aacgagcccaagtacaaggtggtccaggacacctaccagatcatgaaggtggaggggcac
gtctttccagaattcaaagagagcgatgccatgtttgctgccgagagagccccagactgg
gtggacgctgaggaatgccaccgctgcagggtgcagttcggggtgatgacccgtaagcac
cactgccgggcgtgtgggcagatattctgtggaaagtgttcttccaagtactccaccatc
cccaagtttggcatcgagaaggaggtgcgcgtgtgtgagccctgctacgagcagctgaac
aggaaagcggagggaaaggccacttccaccactgagctgccccccgagtacctgaccagc
cccctgtctcagcagtcccagctgccccccaagagggacgagacggccctgcaggaggag
gaggagctgcagctggccctggcgctgtcacagtcagaggcggaggagaaggagaggctg
agacagaagtccacgtacacttcgtaccccaaggcggagcccatgccctcggcctcctca
gcgccccccgccagcagcctgtactcttcacctgtgaactcgtcggcgcctctggctgag
gacatcgaccctgagctcgcacggtatctcaaccggaactactgggagaagaagcaggag
gaggctcgcaagagccccacgccatctgcgcccgtgcccctgacggagccggctgcacag
cctggggaagggcacgcagcccccaccaacgtggtggagaaccccctcccggagacagac
tctcagcccattcctccctctggtggcccctttagtgagccacagttccacaatggcgag
tctgaggagagccacgagcagttcctgaaggcgctgcagaacgccgtcaccaccttcgtg
aaccgcatgaagagtaaccacatgcggggccgcagcatcaccaatgactcggccgtgctc
tcactcttccagtccatcaacggcatgcacccgcagctgctggagctgctcaaccagctg
gacgagcgcaggctgtactatgaggggctgcaggacaagctggcacagatccgcgatgcc
cggggggcgctgagtgccctgcgcgaagagcaccgggagaagcttcgccgggcagccgag
gaggcagagcgccagcgccagatccagctggcccagaagctggagataatgcggcagaag
aagcaggagtacctggaggtgcagaggcagctggccatccagcgcctgcaggagcaggag
aaggagcggcagatgcggctggagcagcagaagcagacggtccagatgcgcgcgcagatg
cccgccttccccctgccctacgcccagctccaggccatgcccgcagccggaggtgtgctc
taccagccctcgggaccagccagcttccccagcaccttcagccctgccggctcggtggag
ggctccccaatgcacggcgtgtacatgagccagccggcccctgccgctggcccctacccc
agcatgcccagcactgcggctgatcccagcatggtgagtgcctacatgtacccagcaggg
gccactggggcgcaggcggccccccaggcccaggccggacccaccgccagccccgcttac
tcatcctaccagcctactcccacagcgggctaccagaacgtggcctcccaggccccacag
agcctcccggccatctctcagcctccgcagtccagcaccatgggctacatggggagccag
tcagtctccatgggctaccagccttacaacatgcagaatctcatgaccaccctcccaagc
caggatgcgtctctgccaccccagcagccctacatcgcggggcagcagcccatgtaccag
cagatggcaccctctggcggtcccccccagcagcagccccccgtggcccagcaaccgcag
gcacaggggccgccggcacagggcagcgaggcccagctcatttcattcgactga

DBGET integrated database retrieval system