KEGG   Homo sapiens (human): 916Help
Entry
916               CDS       T01001                                 

Gene name
CD3E, IMD18, T3E, TCRE
Definition
(RefSeq) CD3e molecule
  KO
K06451  
T-cell surface glycoprotein CD3 epsilon chain
Organism
hsa  Homo sapiens (human)
Pathway
Hematopoietic cell lineage
Th1 and Th2 cell differentiation
Th17 cell differentiation
T cell receptor signaling pathway
Chagas disease (American trypanosomiasis)
Measles
HTLV-I infection
Primary immunodeficiency
Disease
H00091  
T-B+Severe combined immunodeficiencies (SCIDs)
Drug target
Blinatumomab: 
Catumaxomab: 
Muromonab-CD3: 
Otelixizumab: 
Teplizumab: 
Visilizumab: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    916 (CD3E)
   04660 T cell receptor signaling pathway
    916 (CD3E)
   04658 Th1 and Th2 cell differentiation
    916 (CD3E)
   04659 Th17 cell differentiation
    916 (CD3E)
 Human Diseases
  Immune diseases
   05340 Primary immunodeficiency
    916 (CD3E)
  Infectious diseases
   05166 HTLV-I infection
    916 (CD3E)
   05162 Measles
    916 (CD3E)
   05142 Chagas disease (American trypanosomiasis)
    916 (CD3E)
Cellular antigens [BR:hsa04090]
 Proteins
  916 (CD3E)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
P07766(Tclin)
UniProt: 
Structure
PDB: 

Jmol
Position
11q23.3
AA seq 207 aa AA seqDB search
MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQ
HNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCE
NCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERP
PPVPNPDYEPIRKGQRDLYSGLNQRRI
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgcagtcgggcactcactggagagttctgggcctctgcctcttatcagttggcgtttgg
gggcaagatggtaatgaagaaatgggtggtattacacagacaccatataaagtctccatc
tctggaaccacagtaatattgacatgccctcagtatcctggatctgaaatactatggcaa
cacaatgataaaaacataggcggtgatgaggatgataaaaacataggcagtgatgaggat
cacctgtcactgaaggaattttcagaattggagcaaagtggttattatgtctgctacccc
agaggaagcaaaccagaagatgcgaacttttatctctacctgagggcaagagtgtgtgag
aactgcatggagatggatgtgatgtcggtggccacaattgtcatagtggacatctgcatc
actgggggcttgctgctgctggtttactactggagcaagaatagaaaggccaaggccaag
cctgtgacacgaggagcgggtgctggcggcaggcaaaggggacaaaacaaggagaggcca
ccacctgttcccaacccagactatgagcccatccggaaaggccagcgggacctgtattct
ggcctgaatcagagacgcatctga

DBGET integrated database retrieval system