KEGG   Homo sapiens (human): 916Help
Entry
916               CDS       T01001                                 

Gene name
CD3E, IMD18, T3E, TCRE
Definition
(RefSeq) CD3e molecule
  KO
K06451  
T-cell surface glycoprotein CD3 epsilon chain
Organism
hsa  Homo sapiens (human)
Pathway
Hematopoietic cell lineage
T cell receptor signaling pathway
Chagas disease (American trypanosomiasis)
Measles
HTLV-I infection
Primary immunodeficiency
Disease
H00091  
T-B+Severe combined immunodeficiencies (SCIDs)
Drug target
Blinatumomab: 
Catumaxomab: 
Muromonab-CD3: 
Otelixizumab: 
Teplizumab: 
Visilizumab: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    916 (CD3E)
   04660 T cell receptor signaling pathway
    916 (CD3E)
 Human Diseases
  Immune diseases
   05340 Primary immunodeficiency
    916 (CD3E)
  Infectious diseases
   05166 HTLV-I infection
    916 (CD3E)
   05162 Measles
    916 (CD3E)
   05142 Chagas disease (American trypanosomiasis)
    916 (CD3E)
Cellular antigens [BR:hsa04090]
 Proteins
  916 (CD3E)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11q23
AA seq 207 aa AA seqDB search
MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQ
HNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCE
NCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERP
PPVPNPDYEPIRKGQRDLYSGLNQRRI
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgcagtcgggcactcactggagagttctgggcctctgcctcttatcagttggcgtttgg
gggcaagatggtaatgaagaaatgggtggtattacacagacaccatataaagtctccatc
tctggaaccacagtaatattgacatgccctcagtatcctggatctgaaatactatggcaa
cacaatgataaaaacataggcggtgatgaggatgataaaaacataggcagtgatgaggat
cacctgtcactgaaggaattttcagaattggagcaaagtggttattatgtctgctacccc
agaggaagcaaaccagaagatgcgaacttttatctctacctgagggcaagagtgtgtgag
aactgcatggagatggatgtgatgtcggtggccacaattgtcatagtggacatctgcatc
actgggggcttgctgctgctggtttactactggagcaagaatagaaaggccaaggccaag
cctgtgacacgaggagcgggtgctggcggcaggcaaaggggacaaaacaaggagaggcca
ccacctgttcccaacccagactatgagcccatccggaaaggccagcgggacctgtattct
ggcctgaatcagagacgcatctga

DBGET integrated database retrieval system