KEGG   Homo sapiens (human): 917Help
Entry
917               CDS       T01001                                 

Gene name
CD3G, CD3-GAMMA, T3G
Definition
CD3g molecule, gamma (CD3-TCR complex)
Orthology
K06452  
T-cell surface glycoprotein CD3 gamma chain
Organism
hsa  Homo sapiens (human)
Pathway
Hematopoietic cell lineage
T cell receptor signaling pathway
Chagas disease (American trypanosomiasis)
Measles
HTLV-I infection
Drug target
Catumaxomab: 
Muromonab-CD3: 
Other: 
Class
Organismal Systems; Immune system; Hematopoietic cell lineage [PATH:hsa04640]
Organismal Systems; Immune system; T cell receptor signaling pathway [PATH:hsa04660]
Human Diseases; Infectious diseases; HTLV-I infection [PATH:hsa05166]
Human Diseases; Infectious diseases; Measles [PATH:hsa05162]
Human Diseases; Infectious diseases; Chagas disease (American trypanosomiasis) [PATH:hsa05142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
11q23
AA seq 182 aa AA seqDB search
MEQGKGLAVLILAIILLQGTLAQSIKGNHLVKVYDYQEDGSVLLTCDAEAKNITWFKDGK
MIGFLTEDKKKWNLGSNAKDPRGMYQCKGSQNKSKPLQVYYRMCQNCIELNAATISGFLF
AEIVSIFVLAVGVYFIAGQDGVRQSRASDKQTLLPNDQLYQPLKDREDDQYSHLQGNQLR
RN
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atggaacaggggaagggcctggctgtcctcatcctggctatcattcttcttcaaggtact
ttggcccagtcaatcaaaggaaaccacttggttaaggtgtatgactatcaagaagatggt
tcggtacttctgacttgtgatgcagaagccaaaaatatcacatggtttaaagatgggaag
atgatcggcttcctaactgaagataaaaaaaaatggaatctgggaagtaatgccaaggac
cctcgagggatgtatcagtgtaaaggatcacagaacaagtcaaaaccactccaagtgtat
tacagaatgtgtcagaactgcattgaactaaatgcagccaccatatctggctttctcttt
gctgaaatcgtcagcattttcgtccttgctgttggggtctacttcattgctggacaggat
ggagttcgccagtcgagagcttcagacaagcagactctgttgcccaatgaccagctctac
cagcccctcaaggatcgagaagatgaccagtacagccaccttcaaggaaaccagttgagg
aggaattga

DBGET integrated database retrieval system