KEGG   Homo sapiens (human): 91869Help
Entry
91869             CDS       T01001                                 

Gene name
RFT1, CDG1N
Definition
RFT1 homolog (S. cerevisiae)
Orthology
K06316  
oligosaccharide translocation protein RFT1
Organism
hsa  Homo sapiens (human)
Disease
H00118  
Congenital disorders of glycosylation (CDG) type I
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3p21.1
AA seq 541 aa AA seqDB search
MGSQEVLGHAARLASSGLLLQVLFRLITFVLNAFILRFLSKEIVGVVNVRLTLLYSTTLF
LAREAFRRACLSGGTQRDWSQTLNLLWLTVPLGVFWSLFLGWIWLQLLEVPDPNVVPHYA
TGVVLFGLSAVVELLGEPFWVLAQAHMFVKLKVIAESLSVILKSVLTAFLVLWLPHWGLY
IFSLAQLFYTTVLVLCYVIYFTKLLGSPESTKLQTLPVSRITDLLPNITRNGAFINWKEA
KLTWSFFKQSFLKQILTEGERYVMTFLNVLNFGDQGVYDIVNNLGSLVARLIFQPIEESF
YIFFAKVLERGKDATLQKQEDVAVAAAVLESLLKLALLAGLTITVFGFAYSQLALDIYGG
TMLSSGSGPVLLRSYCLYVLLLAINGVTECFTFAAMSKEEVDRYNFVMLALSSSFLVLSY
LLTRWCGSVGFILANCFNMGIRITQSLCFIHRYYRRSPHRPLAGLHLSPVLLGTFALSGG
VTAVSEVFLCCEQGWPARLAHIAVGAFCLGATLGTAFLTETKLIHFLRTQLGVPRRTDKM
T
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgggcagccaggaggtgctgggccacgcggcccggctggcctcctccggtctcctcctg
caggtgttgtttcggttgatcacctttgtcttgaatgcatttattcttcgcttcctgtca
aaggaaatcgttggcgtagtaaatgtaagactaacgctgctttactcaaccaccctcttc
ctggccagagaggccttccgcagagcatgtctcagtgggggcacccagcgagactggagc
cagaccctcaacctgctgtggctaacagtccccctgggtgtgttttggtccttattcctg
ggctggatctggttgcagctgcttgaagtgcctgatcctaatgttgtccctcactatgca
actggagtggtgctgtttggtctctcggcagtggtggagcttctaggagagcccttttgg
gtcttggcacaagcacatatgtttgtgaagctcaaggtgattgcagagagcctgtcggta
attcttaagagcgttctgacagcttttctcgtgctgtggttgcctcactggggattgtac
attttctctttggcccagcttttctataccacagttctggtgctctgctatgttatttat
ttcacaaagttactgggttccccagaatcaaccaagcttcaaactcttcctgtctccaga
ataacagatctgttacccaatattacaagaaatggagcgtttataaactggaaagaggct
aaactgacttggagttttttcaaacagtctttcttgaaacagattttgacagaaggcgag
cgatatgtgatgacatttttgaatgtattgaactttggtgatcagggtgtgtatgatata
gtgaataatcttggctcccttgtggccagattaattttccagccaatagaggaaagtttt
tatatattttttgctaaggtgctggagaggggaaaggatgccacacttcagaagcaggag
gacgttgctgtggctgctgcagtcttggagtccctgctcaagctggccctgctggccggc
ctgaccatcactgtttttggctttgcctattctcagctggctctggatatctacggaggg
accatgcttagctcaggatccggtcctgttttgctgcgttcctactgtctctatgttctc
ctgcttgccatcaatggagtgacagagtgtttcacatttgctgccatgagcaaagaggag
gtcgacaggtacaattttgtgatgctggccctgtcctcctcattcctggtgttatcctat
ctcttgacccgttggtgtggcagcgtgggcttcatcttggccaactgctttaacatgggc
attcggatcacgcagagcctttgcttcatccaccgctactaccgaaggagcccccacagg
cccctggctggcctgcacctatcgccagtcctgctcgggacatttgccctcagtggtggg
gttactgctgtttcggaggtattcctctgctgtgagcagggctggccagccagactggca
cacattgctgtgggggccttctgtctgggagcaactctcgggacagcattcctcacagag
accaagctgatccatttcctcaggactcagttaggtgtgcccagacgcactgacaaaatg
acatga

DBGET integrated database retrieval system