KEGG   Homo sapiens (human): 920Help
Entry
920               CDS       T01001                                 

Gene name
CD4, CD4mut
Definition
(RefSeq) CD4 molecule
  KO
K06454  
CD4 antigen
Organism
hsa  Homo sapiens (human)
Pathway
Cell adhesion molecules (CAMs)
Antigen processing and presentation
Hematopoietic cell lineage
T cell receptor signaling pathway
Primary immunodeficiency
Drug target
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    920 (CD4)
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    920 (CD4)
   04612 Antigen processing and presentation
    920 (CD4)
   04660 T cell receptor signaling pathway
    920 (CD4)
 Human Diseases
  Immune diseases
   05340 Primary immunodeficiency
    920 (CD4)
Cell adhesion molecules and their ligands [BR:hsa04516]
 1. Immunoglobulin Superfamily
  Immune system
   MHC
    MHC2; major histocompatibility complex, class II [KO:K06752]
     920 (CD4)
Cellular antigens [BR:hsa04090]
 Proteins
  920 (CD4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
12p13.31
AA seq 458 aa AA seqDB search
MNRGVPFRHLLLVLQLALLPAATQGKKVVLGKKGDTVELTCTASQKKSIQFHWKNSNQIK
ILGNQGSFLTKGPSKLNDRADSRRSLWDQGNFPLIIKNLKIEDSDTYICEVEDQKEEVQL
LVFGLTANSDTHLLQGQSLTLTLESPPGSSPSVQCRSPRGKNIQGGKTLSVSQLELQDSG
TWTCTVLQNQKKVEFKIDIVVLAFQKASSIVYKKEGEQVEFSFPLAFTVEKLTGSGELWW
QAERASSSKSWITFDLKNKEVSVKRVTQDPKLQMGKKLPLHLTLPQALPQYAGSGNLTLA
LEAKTGKLHQEVNLVVMRATQLQKNLTCEVWGPTSPKLMLSLKLENKEAKVSKREKAVWV
LNPEAGMWQCLLSDSGQVLLESNIKVLPTWSTPVQPMALIVLGGVAGLLLFIGLGIFFCV
RCRHRRRQAERMSQIKRLLSEKKTCQCPHRFQKTCSPI
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgaaccggggagtcccttttaggcacttgcttctggtgctgcaactggcgctcctccca
gcagccactcagggaaagaaagtggtgctgggcaaaaaaggggatacagtggaactgacc
tgtacagcttcccagaagaagagcatacaattccactggaaaaactccaaccagataaag
attctgggaaatcagggctccttcttaactaaaggtccatccaagctgaatgatcgcgct
gactcaagaagaagcctttgggaccaaggaaactttcccctgatcatcaagaatcttaag
atagaagactcagatacttacatctgtgaagtggaggaccagaaggaggaggtgcaattg
ctagtgttcggattgactgccaactctgacacccacctgcttcaggggcagagcctgacc
ctgaccttggagagcccccctggtagtagcccctcagtgcaatgtaggagtccaaggggt
aaaaacatacagggggggaagaccctctccgtgtctcagctggagctccaggatagtggc
acctggacatgcactgtcttgcagaaccagaagaaggtggagttcaaaatagacatcgtg
gtgctagctttccagaaggcctccagcatagtctataagaaagagggggaacaggtggag
ttctccttcccactcgcctttacagttgaaaagctgacgggcagtggcgagctgtggtgg
caggcggagagggcttcctcctccaagtcttggatcacctttgacctgaagaacaaggaa
gtgtctgtaaaacgggttacccaggaccctaagctccagatgggcaagaagctcccgctc
cacctcaccctgccccaggccttgcctcagtatgctggctctggaaacctcaccctggcc
cttgaagcgaaaacaggaaagttgcatcaggaagtgaacctggtggtgatgagagccact
cagctccagaaaaatttgacctgtgaggtgtggggacccacctcccctaagctgatgctg
agtttgaaactggagaacaaggaggcaaaggtctcgaagcgggagaaggcggtgtgggtg
ctgaaccctgaggcggggatgtggcagtgtctgctgagtgactcgggacaggtcctgctg
gaatccaacatcaaggttctgcccacatggtccaccccggtgcagccaatggccctgatt
gtgctggggggcgtcgccggcctcctgcttttcattgggctaggcatcttcttctgtgtc
aggtgccggcaccgaaggcgccaagcagagcggatgtctcagatcaagagactcctcagt
gagaagaagacctgccagtgtcctcaccggtttcagaagacatgtagccccatttga

DBGET integrated database retrieval system