KEGG   Homo sapiens (human): 9246Help
Entry
9246              CDS       T01001                                 

Gene name
UBE2L6, RIG-B, UBCH8
Definition
(RefSeq) ubiquitin conjugating enzyme E2 L6
  KO
K04553  
ubiquitin-conjugating enzyme E2 L6 [EC:2.3.2.23]
Organism
hsa  Homo sapiens (human)
Pathway
Ubiquitin mediated proteolysis
Parkinson's disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    9246 (UBE2L6)
 Human Diseases
  Neurodegenerative diseases
   05012 Parkinson's disease
    9246 (UBE2L6)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     9246 (UBE2L6)
Ubiquitin system [BR:hsa04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   9246 (UBE2L6)
  UBL-conjugating enzymes
   9246 (UBE2L6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11q12
AA seq 153 aa AA seqDB search
MMASMRVVKELEDLQKKPPPYLRNLSSDDANVLVWHALLLPDQPPYHLKAFNLRISFPPE
YPFKPPMIKFTTKIYHPNVDENGQICLPIISSENWKPCTKTCQVLEALNVLVNRPNIREP
LRMDLADLLTQNPELFRKNAEEFTLRFGVDRPS
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgatggcgagcatgcgagtggtgaaggagctggaggatcttcagaagaagcctccccca
tacctgcggaacctgtccagcgatgatgccaatgtcctggtgtggcacgctctcctccta
cccgaccaacctccctaccacctgaaagccttcaacctgcgcatcagcttcccgccggag
tatccgttcaagcctcccatgatcaaattcacaaccaagatctaccaccccaacgtggac
gagaacggacagatttgcctgcccatcatcagcagtgagaactggaagccttgcaccaag
acttgccaagtcctggaggccctcaatgtgctggtgaatagaccgaatatcagggagccc
ctgcggatggacctcgctgacctgctgacacagaatccggagctgttcagaaagaatgcc
gaagagttcaccctccgattcggagtggaccggccctcctaa

DBGET integrated database retrieval system