KEGG   Homo sapiens (human): 9246Help
Entry
9246              CDS       T01001                                 

Gene name
UBE2L6, RIG-B, UBCH8
Definition
ubiquitin-conjugating enzyme E2L 6 (EC:6.3.2.19)
Orthology
K04553  
ubiquitin-conjugating enzyme E2 L6 [EC:6.3.2.19]
Organism
hsa  Homo sapiens (human)
Pathway
Ubiquitin mediated proteolysis
Parkinson's disease
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:hsa04120]
Human Diseases; Neurodegenerative diseases; Parkinson's disease [PATH:hsa05012]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11q12
AA seq 153 aa AA seqDB search
MMASMRVVKELEDLQKKPPPYLRNLSSDDANVLVWHALLLPDQPPYHLKAFNLRISFPPE
YPFKPPMIKFTTKIYHPNVDENGQICLPIISSENWKPCTKTCQVLEALNVLVNRPNIREP
LRMDLADLLTQNPELFRKNAEEFTLRFGVDRPS
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgatggcgagcatgcgagtggtgaaggagctggaggatcttcagaagaagcctccccca
tacctgcggaacctgtccagcgatgatgccaatgtcctggtgtggcacgctctcctccta
cccgaccaacctccctaccacctgaaagccttcaacctgcgcatcagcttcccgccggag
tatccgttcaagcctcccatgatcaaattcacaaccaagatctaccaccccaacgtggac
gagaacggacagatttgcctgcccatcatcagcagtgagaactggaagccttgcaccaag
acttgccaagtcctggaggccctcaatgtgctggtgaatagaccgaatatcagggagccc
ctgcggatggacctcgctgacctgctgacacagaatccggagctgttcagaaagaatgcc
gaagagttcaccctccgattcggagtggaccggccctcctaa

DBGET integrated database retrieval system