KEGG   Homo sapiens (human): 925Help
Entry
925               CDS       T01001                                 

Gene name
CD8A, CD8, Leu2, MAL, p32
Definition
CD8a molecule
Orthology
K06458  
CD8A antigen, alpha polypeptide
Organism
hsa  Homo sapiens (human)
Pathway
Cell adhesion molecules (CAMs)
Antigen processing and presentation
Hematopoietic cell lineage
T cell receptor signaling pathway
Primary immunodeficiency
Disease
H00093  
Combined immunodeficiencies (CIDs)
Class
Environmental Information Processing; Signaling molecules and interaction; Cell adhesion molecules (CAMs) [PATH:hsa04514]
Organismal Systems; Immune system; Hematopoietic cell lineage [PATH:hsa04640]
Organismal Systems; Immune system; Antigen processing and presentation [PATH:hsa04612]
Organismal Systems; Immune system; T cell receptor signaling pathway [PATH:hsa04660]
Human Diseases; Immune diseases; Primary immunodeficiency [PATH:hsa05340]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2p12
AA seq 235 aa AA seqDB search
MALPVTALLLPLALLLHAARPSQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQP
RGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSN
SIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFA
CDIYIWAPLAGTCGVLLLSLVITLYCNHRNRRRVCKCPRPVVKSGDKPSLSARYV
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atggccttaccagtgaccgccttgctcctgccgctggccttgctgctccacgccgccagg
ccgagccagttccgggtgtcgccgctggatcggacctggaacctgggcgagacagtggag
ctgaagtgccaggtgctgctgtccaacccgacgtcgggctgctcgtggctcttccagccg
cgcggcgccgccgccagtcccaccttcctcctatacctctcccaaaacaagcccaaggcg
gccgaggggctggacacccagcggttctcgggcaagaggttgggggacaccttcgtcctc
accctgagcgacttccgccgagagaacgagggctactatttctgctcggccctgagcaac
tccatcatgtacttcagccacttcgtgccggtcttcctgccagcgaagcccaccacgacg
ccagcgccgcgaccaccaacaccggcgcccaccatcgcgtcgcagcccctgtccctgcgc
ccagaggcgtgccggccagcggcggggggcgcagtgcacacgagggggctggacttcgcc
tgtgatatctacatctgggcgcccttggccgggacttgtggggtccttctcctgtcactg
gttatcaccctttactgcaaccacaggaaccgaagacgtgtttgcaaatgtccccggcct
gtggtcaaatcgggagacaagcccagcctttcggcgagatacgtctaa

DBGET integrated database retrieval system