KEGG   Homo sapiens (human): 926Help
Entry
926               CDS       T01001                                 

Gene name
CD8B, CD8B1, LEU2, LY3, LYT3, P37
Definition
CD8b molecule
Orthology
K06459  
CD8B antigen, beta polypeptide
Organism
hsa  Homo sapiens (human)
Pathway
Cell adhesion molecules (CAMs)
Antigen processing and presentation
Hematopoietic cell lineage
T cell receptor signaling pathway
Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    926 (CD8B)
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    926 (CD8B)
   04612 Antigen processing and presentation
    926 (CD8B)
   04660 T cell receptor signaling pathway
    926 (CD8B)
 Human Diseases
  Immune diseases
   05340 Primary immunodeficiency
    926 (CD8B)
Cellular antigens [BR:hsa04090]
 Proteins
  926 (CD8B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2p12
AA seq 198 aa AA seqDB search
MRPRLWLLLAAQLTVLHGNSVLQQTPAYIKVQTNKMVMLSCEAKISLSNMRIYWLRQRQA
PSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFILNLTSVKPEDSGIYFCMIVG
SPELTFGKGTQLSVVDFLPTTAQPTKKSTLKKRVCRLPRPETQKGLKGKVYQEPLSPNAC
MDTTAILQPHRSCLTHGS
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgcggccgcggctgtggctcctcttggccgcgcagctgacagttctccatggcaactca
gtcctccagcagacccctgcatacataaaggtgcaaaccaacaagatggtgatgctgtcc
tgcgaggctaaaatctccctcagtaacatgcgcatctactggctgagacagcgccaggca
ccgagcagtgacagtcaccacgagttcctggccctctgggattccgcaaaagggactatc
cacggtgaagaggtggaacaggagaagatagctgtgtttcgggatgcaagccggttcatt
ctcaatctcacaagcgtgaagccggaagacagtggcatctacttctgcatgatcgtcggg
agccccgagctgaccttcgggaagggaactcagctgagtgtggttgatttccttcccacc
actgcccagcccaccaagaagtccaccctcaagaagagagtgtgccggttacccaggcca
gagacccagaagggcctcaaggggaaggtatatcaggaacctttgtcccccaatgcctgc
atggatactacagcaatactacaacctcacagaagctgcttaacccatggatcctga

DBGET integrated database retrieval system