KEGG   Homo sapiens (human): 92815Help
Entry
92815             CDS       T01001                                 

Gene name
HIST3H2A
Definition
histone cluster 3, H2a
Orthology
K11251  
histone H2A
Organism
hsa  Homo sapiens (human)
Pathway
Alcoholism
Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Immune diseases
   05322 Systemic lupus erythematosus
    92815 (HIST3H2A)
  Substance dependence
   05034 Alcoholism
    92815 (HIST3H2A)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   92815 (HIST3H2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1q42.13
AA seq 130 aa AA seqDB search
MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKK
TESHHKAKGK
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgtccggtcgtggtaagcagggtggcaaggcgcgcgccaaggctaagtcgcgctcgtcg
cgcgcggggctgcagttccccgtgggccgcgtgcaccggttgctccgcaagggcaactat
tcggagcgcgtgggcgccggcgccccggtctatctggccgcggtgctcgagtacttgact
gccgagatcctggagcttgccggcaacgcggcgcgcgacaacaagaagacgcgcatcatc
ccgcgccacctgcagctggccatccgcaacgacgaggagctcaacaagctgctgggccgc
gtgaccatcgcgcagggtggcgtcctgcccaacatccaggccgtactgctgcccaagaag
acggagagccaccacaaggccaagggcaagtga

DBGET integrated database retrieval system