KEGG   Homo sapiens (human): 92815Help
Entry
92815             CDS       T01001                                 

Gene name
HIST3H2A
Definition
histone cluster 3, H2a
Orthology
K11251  
histone H2A
Organism
hsa  Homo sapiens (human)
Pathway
Alcoholism
Systemic lupus erythematosus
Class
Human Diseases; Immune diseases; Systemic lupus erythematosus [PATH:hsa05322]
Human Diseases; Substance dependence; Alcoholism [PATH:hsa05034]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1q42.13
AA seq 130 aa AA seqDB search
MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKK
TESHHKAKGK
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgtccggtcgtggtaagcagggtggcaaggcgcgcgccaaggctaagtcgcgctcgtcg
cgcgcggggctgcagttccccgtgggccgcgtgcaccggttgctccgcaagggcaactat
tcggagcgcgtgggcgccggcgccccggtctatctggccgcggtgctcgagtacttgact
gccgagatcctggagcttgccggcaacgcggcgcgcgacaacaagaagacgcgcatcatc
ccgcgccacctgcagctggccatccgcaacgacgaggagctcaacaagctgctgggccgc
gtgaccatcgcgcagggtggcgtcctgcccaacatccaggccgtactgctgcccaagaag
acggagagccaccacaaggccaagggcaagtga

DBGET integrated database retrieval system