KEGG   Homo sapiens (human): 929Help
Entry
929               CDS       T01001                                 

Gene name
CD14
Definition
CD14 molecule
Orthology
K04391  
CD14 antigen
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
NF-kappa B signaling pathway
Phagosome
Toll-like receptor signaling pathway
Hematopoietic cell lineage
Regulation of actin cytoskeleton
Pathogenic Escherichia coli infection
Salmonella infection
Pertussis
Legionellosis
Amoebiasis
Tuberculosis
Transcriptional misregulation in cancer
Disease
H00079  
Asthma
H01360  
Allergic rhinitis
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:hsa04010]
Environmental Information Processing; Signal transduction; NF-kappa B signaling pathway [PATH:hsa04064]
Cellular Processes; Transport and catabolism; Phagosome [PATH:hsa04145]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:hsa04810]
Organismal Systems; Immune system; Hematopoietic cell lineage [PATH:hsa04640]
Organismal Systems; Immune system; Toll-like receptor signaling pathway [PATH:hsa04620]
Human Diseases; Cancers; Transcriptional misregulation in cancers [PATH:hsa05202]
Human Diseases; Infectious diseases; Pathogenic Escherichia coli infection [PATH:hsa05130]
Human Diseases; Infectious diseases; Salmonella infection [PATH:hsa05132]
Human Diseases; Infectious diseases; Pertussis [PATH:hsa05133]
Human Diseases; Infectious diseases; Legionellosis [PATH:hsa05134]
Human Diseases; Infectious diseases; Tuberculosis [PATH:hsa05152]
Human Diseases; Infectious diseases; Amoebiasis [PATH:hsa05146]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
5q31.1
AA seq 375 aa AA seqDB search
MERASCLLLLLLPLVHVSATTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIH
AGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKE
LTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQA
HSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGV
CAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLR
VLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVPACARSTLSVG
VSGTLVLLQGARGFA
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggagcgcgcgtcctgcttgttgctgctgctgctgccgctggtgcacgtctctgcgacc
acgccagaaccttgtgagctggacgatgaagatttccgctgcgtctgcaacttctccgaa
cctcagcccgactggtccgaagccttccagtgtgtgtctgcagtagaggtggagatccat
gccggcggtctcaacctagagccgtttctaaagcgcgtcgatgcggacgccgacccgcgg
cagtatgctgacacggtcaaggctctccgcgtgcggcggctcacagtgggagccgcacag
gttcctgctcagctactggtaggcgccctgcgtgtgctagcgtactcccgcctcaaggaa
ctgacgctcgaggacctaaagataaccggcaccatgcctccgctgcctctggaagccaca
ggacttgcactttccagcttgcgcctacgcaacgtgtcgtgggcgacagggcgttcttgg
ctcgccgagctgcagcagtggctcaagccaggcctcaaggtactgagcattgcccaagca
cactcgcctgccttttcctgcgaacaggttcgcgccttcccggcccttaccagcctagac
ctgtctgacaatcctggactgggcgaacgcggactgatggcggctctctgtccccacaag
ttcccggccatccagaatctagcgctgcgcaacacaggaatggagacgcccacaggcgtg
tgcgccgcactggcggcggcaggtgtgcagccccacagcctagacctcagccacaactcg
ctgcgcgccaccgtaaaccctagcgctccgagatgcatgtggtccagcgccctgaactcc
ctcaatctgtcgttcgctgggctggaacaggtgcctaaaggactgccagccaagctcaga
gtgctcgatctcagctgcaacagactgaacagggcgccgcagcctgacgagctgcccgag
gtggataacctgacactggacgggaatcccttcctggtccctggaactgccctcccccac
gagggctcaatgaactccggcgtggtcccagcctgtgcacgttcgaccctgtcggtgggg
gtgtcgggaaccctggtgctgctccaaggggcccggggctttgcctaa

DBGET integrated database retrieval system