KEGG   Homo sapiens (human): 929Help
Entry
929               CDS       T01001                                 

Gene name
CD14
Definition
CD14 molecule
Orthology
K04391  
CD14 antigen
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
NF-kappa B signaling pathway
Phagosome
Toll-like receptor signaling pathway
Hematopoietic cell lineage
Regulation of actin cytoskeleton
Pathogenic Escherichia coli infection
Salmonella infection
Pertussis
Legionellosis
Amoebiasis
Tuberculosis
Transcriptional misregulation in cancer
Disease
H00079  
Asthma
H01360  
Allergic rhinitis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    929 (CD14)
   04064 NF-kappa B signaling pathway
    929 (CD14)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    929 (CD14)
  Cell motility
   04810 Regulation of actin cytoskeleton
    929 (CD14)
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    929 (CD14)
   04620 Toll-like receptor signaling pathway
    929 (CD14)
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    929 (CD14)
  Infectious diseases
   05130 Pathogenic Escherichia coli infection
    929 (CD14)
   05132 Salmonella infection
    929 (CD14)
   05133 Pertussis
    929 (CD14)
   05134 Legionellosis
    929 (CD14)
   05152 Tuberculosis
    929 (CD14)
   05146 Amoebiasis
    929 (CD14)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   929 (CD14)
Cellular antigens [BR:hsa04090]
 Proteins
  929 (CD14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
5q31.1
AA seq 375 aa AA seqDB search
MERASCLLLLLLPLVHVSATTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIH
AGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKE
LTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQA
HSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGV
CAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLR
VLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVPACARSTLSVG
VSGTLVLLQGARGFA
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggagcgcgcgtcctgcttgttgctgctgctgctgccgctggtgcacgtctctgcgacc
acgccagaaccttgtgagctggacgatgaagatttccgctgcgtctgcaacttctccgaa
cctcagcccgactggtccgaagccttccagtgtgtgtctgcagtagaggtggagatccat
gccggcggtctcaacctagagccgtttctaaagcgcgtcgatgcggacgccgacccgcgg
cagtatgctgacacggtcaaggctctccgcgtgcggcggctcacagtgggagccgcacag
gttcctgctcagctactggtaggcgccctgcgtgtgctagcgtactcccgcctcaaggaa
ctgacgctcgaggacctaaagataaccggcaccatgcctccgctgcctctggaagccaca
ggacttgcactttccagcttgcgcctacgcaacgtgtcgtgggcgacagggcgttcttgg
ctcgccgagctgcagcagtggctcaagccaggcctcaaggtactgagcattgcccaagca
cactcgcctgccttttcctgcgaacaggttcgcgccttcccggcccttaccagcctagac
ctgtctgacaatcctggactgggcgaacgcggactgatggcggctctctgtccccacaag
ttcccggccatccagaatctagcgctgcgcaacacaggaatggagacgcccacaggcgtg
tgcgccgcactggcggcggcaggtgtgcagccccacagcctagacctcagccacaactcg
ctgcgcgccaccgtaaaccctagcgctccgagatgcatgtggtccagcgccctgaactcc
ctcaatctgtcgttcgctgggctggaacaggtgcctaaaggactgccagccaagctcaga
gtgctcgatctcagctgcaacagactgaacagggcgccgcagcctgacgagctgcccgag
gtggataacctgacactggacgggaatcccttcctggtccctggaactgccctcccccac
gagggctcaatgaactccggcgtggtcccagcctgtgcacgttcgaccctgtcggtgggg
gtgtcgggaaccctggtgctgctccaaggggcccggggctttgcctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system