KEGG   Homo sapiens (human): 9295Help
Entry
9295              CDS       T01001                                 

Gene name
SRSF11, NET2, SFRS11, dJ677H15.2, p54
Definition
(RefSeq) serine/arginine-rich splicing factor 11
  KO
K12899  
splicing factor, arginine/serine-rich 11
Organism
hsa  Homo sapiens (human)
Brite
Spliceosome [BR:hsa03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   SR proteins
    9295 (SRSF11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p31
AA seq 484 aa AA seqDB search
MSNTTVVPSTAGPGPSGGPGGGGGGGGGGGGTEVIQVTNVSPSASSEQMRTLFGFLGKID
ELRLFPPDDSPLPVSSRVCFVKFHDPDSAVVAQHLTNTVFVDRALIVVPYAEGVIPDEAK
ALSLLAPANAVAGLLPGGGLLPTPNPLTQIGAVPLAALGAPTLDPALAALGLPGANLNSQ
SLAADQLLKLMSTVDPKLNHVAAGLVSPSLKSDTSSKEIEEAMKRVREAQSLISAAIEPD
KKEEKRRHSRSRSRSRRRRTPSSSRHRRSRSRSRRRSHSKSRSRRRSKSPRRRRSHSRER
GRRSRSTSKTRDKKKEDKEKKRSKTPPKSYSTARRSRSASRERRRRRSRSGTRSPKKPRS
PKRKLSRSPSPRRHKKEKKKDKDKERSRDERERSTSKKKKSKDKEKDRERKSESDKDVKQ
VTRDYDEEEQGYDSEKEKKEEKKPIETGSPKTKECSVEKGTGDSLRESKVNGDDHHEEDM
DMSD
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacactaccgtcgtccccagcactgcaggtccgggccccagcggcgggcccggt
ggcggaggtggtggtggcggcggaggcggcggcaccgaggtaatccaggtgactaatgtc
tccccgagcgctagctctgagcagatgcggactctcttcggtttcctaggcaagatcgac
gaactgcgcctcttcccgccggatgattcgcctttgccagtctcatctcgtgtctgcttt
gttaagttccatgatccagactcagcagttgtggcacagcatctgacaaacactgtattc
gttgacagagctttgatagtcgtaccatatgcagaaggagttattcctgatgaagctaaa
gctttgtctctgttggcaccagctaatgcagtggcaggtcttctgcctggtggtggactc
ctgcctactcctaacccacttacccagattggcgctgttccactggctgctttgggggct
cctactcttgatcctgcccttgctgcacttgggcttcctggagcaaacttgaactctcag
tctcttgctgcagatcagttgctgaagcttatgagtactgttgatcccaagttgaatcat
gtagctgctggtctcgtttcaccaagtctgaaatcggatacctctagtaaagaaatagag
gaagctatgaaaagagtacgagaagcacagtccctaatttctgctgctatagaaccagat
aagaaagaagaaaaaagaaggcattcaagatcaagatcacgttctaggaggaggaggact
ccctcatcttctagacacaggcggtcaagaagcagatcgagacggcggtcacattctaag
tctaggagtcggcgacgatccaaaagcccaaggcggagaagatctcattccagagaaaga
ggtagaaggtcaaggagcacatcaaaaacaagagacaaaaagaaagaagacaaagaaaag
aaacgttctaaaacaccaccaaaaagttacagcacagccagacgttctagaagtgcaagc
agagagagacgacgacgaagaagcaggagtggcacaagatctcctaaaaagcctcggtct
cctaaaagaaaattgtcccgctcaccatcccctaggagacataaaaaggagaagaagaaa
gataaagacaaagaaagaagtagggatgaaagagaacgatcaacaagcaagaagaagaag
agtaaagataaggaaaaggaccgggaaagaaaatcagagagtgataaagatgtaaaacag
gttacacgggattatgatgaagaggaacaggggtatgacagtgagaaagagaaaaaagaa
gagaagaaaccaatagaaacaggttcccctaaaacaaaggaatgttctgtggaaaaggga
actggtgattcactaagagaatccaaagtgaatggggatgatcatcatgaagaagacatg
gatatgagtgactga

DBGET integrated database retrieval system