KEGG   Homo sapiens (human): 9296Help
Entry
9296              CDS       T01001                                 

Gene name
ATP6V1F, ATP6S14, VATF, Vma7
Definition
ATPase, H+ transporting, lysosomal 14kDa, V1 subunit F (EC:3.6.3.14)
Orthology
K02151  
V-type H+-transporting ATPase subunit F
Organism
hsa  Homo sapiens (human)
Pathway
Oxidative phosphorylation
Metabolic pathways
Phagosome
Synaptic vesicle cycle
Collecting duct acid secretion
Vibrio cholerae infection
Epithelial cell signaling in Helicobacter pylori infection
Rheumatoid arthritis
Module
V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    9296 (ATP6V1F)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    9296 (ATP6V1F)
 Organismal Systems
  Excretory system
   04966 Collecting duct acid secretion
    9296 (ATP6V1F)
  Nervous system
   04721 Synaptic vesicle cycle
    9296 (ATP6V1F)
 Human Diseases
  Immune diseases
   05323 Rheumatoid arthritis
    9296 (ATP6V1F)
  Infectious diseases
   05110 Vibrio cholerae infection
    9296 (ATP6V1F)
   05120 Epithelial cell signaling in Helicobacter pylori infection
    9296 (ATP6V1F)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
7q32
AA seq 147 aa AA seqDB search
MAGRGKLIAVIGDEDTVTGFLLGGIGELNKNRHPNFLVVEKDTTINEIEDTFRSLGSLPG
SVVEANPNQRDPPLWDEIDSRQFLNRDDIGIILINQYIAEMVRHALDAHQQSIPAVLEIP
SKEHPYDAAKDSILRRARGMFTAEDLR
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atggcggggaggggtaagctcatcgcagtgatcggagacgaggacacggtgactggtttc
ctgctgggcggcataggggagcttaacaagaaccgccatcccaatttcctggtggtggag
aaggatacaaccatcaatgagatcgaagacactttccgttcacttggaagccttccgggc
agtgttgtagaagccaaccctaatcagcgtgaccctccgctttgggatgaaattgattct
aggcaatttctaaaccgggatgacattggcatcatcctcatcaaccagtacatcgcagag
atggtgcggcatgccctggacgcccaccagcagtccatccccgctgtcctggagatcccc
tccaaggagcacccatatgacgccgccaaggactccatcctgcgcagggccaggggcatg
ttcactgccgaagacctgcgctag

DBGET integrated database retrieval system