KEGG   Homo sapiens (human): 933Help
Entry
933               CDS       T01001                                 

Gene name
CD22, SIGLEC-2, SIGLEC2
Definition
CD22 molecule
Orthology
K06467  
CD22 antigen
Organism
hsa  Homo sapiens (human)
Pathway
Cell adhesion molecules (CAMs)
Hematopoietic cell lineage
B cell receptor signaling pathway
Drug target
Class
Environmental Information Processing; Signaling molecules and interaction; Cell adhesion molecules (CAMs) [PATH:hsa04514]
Organismal Systems; Immune system; Hematopoietic cell lineage [PATH:hsa04640]
Organismal Systems; Immune system; B cell receptor signaling pathway [PATH:hsa04662]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19q13.1
AA seq 759 aa AA seqDB search
MHLLGPWLLLLVLEYLAFSDSSKWVFEHPETLYAWEGACVWIPCTYRALDGDLESFILFH
NPEYNKNTSKFDGTRLYESTKDGKVPSEQKRVQFLGDKNKNCTLSIHPVHLNDSGQLGLR
MESKTEKWMERIHLNVSERPFPPHIQLPPEIQESQEVTLTCLLNFSCYGYPIQLQWLLEG
VPMRQAAVTSTSLTIKSVFTRSELKFSPQWSHHGKIVTCQLQDADGKFLSNDTVQLNVKH
TPKLEIKVTPSDAIVREGDSVTMTCEVSSSNPEYTTVSWLKDGTSLKKQNTFTLNLREVT
KDQSGKYCCQVSNDVGPGRSEEVFLQVQYPPKKVTTVIQNPMPIREGDTVTLSCNYNSSN
PSVTRYEWKPHGAWEEPSLGVLKIQNVGWDNTTIACAACNSWCSWASPVALNVQYAPRDV
RVRKIKPLSEIHSGNSVSLQCDFSSSHPKEVQFFWEKNGRLLGKESQLNFDSISPEDAGS
YSCWVNNSIGQTASKAWTLEVLYAPRRLRVSMSPGDQVMEGKSATLTCESDANPPVSHYT
WFDWNNQSLPYHSQKLRLEPVKVQHSGAYWCQGTNSVGKGRSPLSTLTVYYSPETIGRRV
AVGLGSCLAILILAICGLKLQRRWKRTQSQQGLQENSSGQSFFVRNKKVRRAPLSEGPHS
LGCYNPMMEDGISYTTLRFPEMNIPRTGDAESSEMQRPPPDCDDTVTYSALHKRQVGDYE
NVIPDFPEDEGIHYSELIQFGVGERPQAQENVDYVILKH
NT seq 2280 nt NT seq  +upstreamnt  +downstreamnt
atgcatctcctcggcccctggctcctgctcctggttctagaatacttggctttctctgac
tcaagtaaatgggtttttgagcaccctgaaaccctctacgcctgggagggggcctgcgtc
tggatcccctgcacctacagagccctagatggtgacctggaaagcttcatcctgttccac
aatcctgagtataacaagaacacctcgaagtttgatgggacaagactctatgaaagcaca
aaggatgggaaggttccttctgagcagaaaagggtgcaattcctgggagacaagaataag
aactgcacactgagtatccacccggtgcacctcaatgacagtggtcagctggggctgagg
atggagtccaagactgagaaatggatggaacgaatacacctcaatgtctctgaaaggcct
tttccacctcatatccagctccctccagaaattcaagagtcccaggaagtcactctgacc
tgcttgctgaatttctcctgctatgggtatccgatccaattgcagtggctcctagagggg
gttccaatgaggcaggctgctgtcacctcgacctccttgaccatcaagtctgtcttcacc
cggagcgagctcaagttctccccacagtggagtcaccatgggaagattgtgacctgccag
cttcaggatgcagatgggaagttcctctccaatgacacggtgcagctgaacgtgaagcac
accccgaagttggagatcaaggtcactcccagtgatgccatagtgagggagggggactct
gtgaccatgacctgcgaggtcagcagcagcaacccggagtacacgacggtatcctggctc
aaggatgggacctcgctgaagaagcagaatacattcacgctaaacctgcgcgaagtgacc
aaggaccagagtgggaagtactgctgtcaggtctccaatgacgtgggcccgggaaggtcg
gaagaagtgttcctgcaagtgcagtatcctcccaagaaggtgaccacagtgattcaaaac
cccatgccgattcgagaaggagacacagtgaccctttcctgtaactacaattccagtaac
cccagtgttacccggtatgaatggaaaccccatggcgcctgggaggagccatcgcttggg
gtgctgaagatccaaaacgttggctgggacaacacaaccatcgcctgcgcagcttgtaat
agttggtgctcgtgggcctcccctgtcgccctgaatgtccagtatgccccccgagacgtg
agggtccggaaaatcaagcccctttccgagattcactctggaaactcggtcagcctccaa
tgtgacttctcaagcagccaccccaaagaagtccagttcttctgggagaaaaatggcagg
cttctggggaaagaaagccagctgaattttgactccatctccccagaagatgctgggagt
tacagctgctgggtgaacaactccataggacagacagcgtccaaggcctggacacttgaa
gtgctgtatgcacccaggaggctgcgtgtgtccatgagcccgggggaccaagtgatggag
gggaagagtgcaaccctgacctgtgagagcgacgccaaccctcccgtctcccactacacc
tggtttgactggaataaccaaagcctcccctaccacagccagaagctgagattggagccg
gtgaaggtccagcactcgggtgcctactggtgccaggggaccaacagtgtgggcaagggc
cgttcgcctctcagcaccctcaccgtctactatagcccggagaccatcggcaggcgagtg
gctgtgggactcgggtcctgcctcgccatcctcatcctggcaatctgtgggctcaagctc
cagcgacgttggaagaggacacagagccagcaggggcttcaggagaattccagcggccag
agcttctttgtgaggaataaaaaggttagaagggcccccctctctgaaggcccccactcc
ctgggatgctacaatccaatgatggaagatggcattagctacaccaccctgcgctttccc
gagatgaacataccacgaactggagatgcagagtcctcagagatgcagagacctcccccg
gactgcgatgacacggtcacttattcagcattgcacaagcgccaagtgggcgactatgag
aacgtcattccagattttccagaagatgaggggattcattactcagagctgatccagttt
ggggtcggggagcggcctcaggcacaagaaaatgtggactatgtgatcctcaaacattga

DBGET integrated database retrieval system