KEGG   Homo sapiens (human): 933Help
Entry
933               CDS       T01001                                 

Gene name
CD22, SIGLEC-2, SIGLEC2
Definition
(RefSeq) CD22 molecule
  KO
K06467  
CD22 antigen
Organism
hsa  Homo sapiens (human)
Pathway
Cell adhesion molecules (CAMs)
Hematopoietic cell lineage
B cell receptor signaling pathway
Drug target
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    933 (CD22)
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    933 (CD22)
   04662 B cell receptor signaling pathway
    933 (CD22)
Cellular antigens [BR:hsa04090]
 Proteins
  933 (CD22)
Lectins [BR:hsa04091]
 I-type lectins (Siglecs)
  933 (CD22)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19q13.1
AA seq 847 aa AA seqDB search
MHLLGPWLLLLVLEYLAFSDSSKWVFEHPETLYAWEGACVWIPCTYRALDGDLESFILFH
NPEYNKNTSKFDGTRLYESTKDGKVPSEQKRVQFLGDKNKNCTLSIHPVHLNDSGQLGLR
MESKTEKWMERIHLNVSERPFPPHIQLPPEIQESQEVTLTCLLNFSCYGYPIQLQWLLEG
VPMRQAAVTSTSLTIKSVFTRSELKFSPQWSHHGKIVTCQLQDADGKFLSNDTVQLNVKH
TPKLEIKVTPSDAIVREGDSVTMTCEVSSSNPEYTTVSWLKDGTSLKKQNTFTLNLREVT
KDQSGKYCCQVSNDVGPGRSEEVFLQVQYAPEPSTVQILHSPAVEGSQVEFLCMSLANPL
PTNYTWYHNGKEMQGRTEEKVHIPKILPWHAGTYSCVAENILGTGQRGPGAELDVQYPPK
KVTTVIQNPMPIREGDTVTLSCNYNSSNPSVTRYEWKPHGAWEEPSLGVLKIQNVGWDNT
TIACAACNSWCSWASPVALNVQYAPRDVRVRKIKPLSEIHSGNSVSLQCDFSSSHPKEVQ
FFWEKNGRLLGKESQLNFDSISPEDAGSYSCWVNNSIGQTASKAWTLEVLYAPRRLRVSM
SPGDQVMEGKSATLTCESDANPPVSHYTWFDWNNQSLPYHSQKLRLEPVKVQHSGAYWCQ
GTNSVGKGRSPLSTLTVYYSPETIGRRVAVGLGSCLAILILAICGLKLQRRWKRTQSQQG
LQENSSGQSFFVRNKKVRRAPLSEGPHSLGCYNPMMEDGISYTTLRFPEMNIPRTGDAES
SEMQRPPPDCDDTVTYSALHKRQVGDYENVIPDFPEDEGIHYSELIQFGVGERPQAQENV
DYVILKH
NT seq 2544 nt NT seq  +upstreamnt  +downstreamnt
atgcatctcctcggcccctggctcctgctcctggttctagaatacttggctttctctgac
tcaagtaaatgggtttttgagcaccctgaaaccctctacgcctgggagggggcctgcgtc
tggatcccctgcacctacagagccctagatggtgacctggaaagcttcatcctgttccac
aatcctgagtataacaagaacacctcgaagtttgatgggacaagactctatgaaagcaca
aaggatgggaaggttccttctgagcagaaaagggtgcaattcctgggagacaagaataag
aactgcacactgagtatccacccggtgcacctcaatgacagtggtcagctggggctgagg
atggagtccaagactgagaaatggatggaacgaatacacctcaatgtctctgaaaggcct
tttccacctcatatccagctccctccagaaattcaagagtcccaggaagtcactctgacc
tgcttgctgaatttctcctgctatgggtatccgatccaattgcagtggctcctagagggg
gttccaatgaggcaggctgctgtcacctcgacctccttgaccatcaagtctgtcttcacc
cggagcgagctcaagttctccccacagtggagtcaccatgggaagattgtgacctgccag
cttcaggatgcagatgggaagttcctctccaatgacacggtgcagctgaacgtgaagcac
accccgaagttggagatcaaggtcactcccagtgatgccatagtgagggagggggactct
gtgaccatgacctgcgaggtcagcagcagcaacccggagtacacgacggtatcctggctc
aaggatgggacctcgctgaagaagcagaatacattcacgctaaacctgcgcgaagtgacc
aaggaccagagtgggaagtactgctgtcaggtctccaatgacgtgggcccgggaaggtcg
gaagaagtgttcctgcaagtgcagtatgccccggaaccttccacggttcagatcctccac
tcaccggctgtggagggaagtcaagtcgagtttctttgcatgtcactggccaatcctctt
ccaacaaattacacgtggtaccacaatgggaaagaaatgcagggaaggacagaggagaaa
gtccacatcccaaagatcctcccctggcacgctgggacttattcctgtgtggcagaaaac
attcttggtactggacagaggggcccgggagctgagctggatgtccagtatcctcccaag
aaggtgaccacagtgattcaaaaccccatgccgattcgagaaggagacacagtgaccctt
tcctgtaactacaattccagtaaccccagtgttacccggtatgaatggaaaccccatggc
gcctgggaggagccatcgcttggggtgctgaagatccaaaacgttggctgggacaacaca
accatcgcctgcgcagcttgtaatagttggtgctcgtgggcctcccctgtcgccctgaat
gtccagtatgccccccgagacgtgagggtccggaaaatcaagcccctttccgagattcac
tctggaaactcggtcagcctccaatgtgacttctcaagcagccaccccaaagaagtccag
ttcttctgggagaaaaatggcaggcttctggggaaagaaagccagctgaattttgactcc
atctccccagaagatgctgggagttacagctgctgggtgaacaactccataggacagaca
gcgtccaaggcctggacacttgaagtgctgtatgcacccaggaggctgcgtgtgtccatg
agcccgggggaccaagtgatggaggggaagagtgcaaccctgacctgtgagagcgacgcc
aaccctcccgtctcccactacacctggtttgactggaataaccaaagcctcccctaccac
agccagaagctgagattggagccggtgaaggtccagcactcgggtgcctactggtgccag
gggaccaacagtgtgggcaagggccgttcgcctctcagcaccctcaccgtctactatagc
ccggagaccatcggcaggcgagtggctgtgggactcgggtcctgcctcgccatcctcatc
ctggcaatctgtgggctcaagctccagcgacgttggaagaggacacagagccagcagggg
cttcaggagaattccagcggccagagcttctttgtgaggaataaaaaggttagaagggcc
cccctctctgaaggcccccactccctgggatgctacaatccaatgatggaagatggcatt
agctacaccaccctgcgctttcccgagatgaacataccacgaactggagatgcagagtcc
tcagagatgcagagacctcccccggactgcgatgacacggtcacttattcagcattgcac
aagcgccaagtgggcgactatgagaacgtcattccagattttccagaagatgaggggatt
cattactcagagctgatccagtttggggtcggggagcggcctcaggcacaagaaaatgtg
gactatgtgatcctcaaacattga

DBGET integrated database retrieval system