KEGG   Homo sapiens (human): 939Help
Entry
939               CDS       T01001                                 

Gene name
CD27, S152, S152._LPFS2, T14, TNFRSF7, Tp55
Definition
CD27 molecule
Orthology
K05144  
tumor necrosis factor receptor superfamily member 7
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    939 (CD27)
Cellular antigens [BR:hsa04090]
 Proteins
  939 (CD27)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12p13
AA seq 260 aa AA seqDB search
MARPHPWWLCVLGTLVGLSATPAPKSCPERHYWAQGKLCCQMCEPGTFLVKDCDQHRKAA
QCDPCIPGVSFSPDHHTRPHCESCRHCNSGLLVRNCTITANAECACRNGWQCRDKECTEC
DPLPNPSLTARSSQALSPHPQPTHLPYVSEMLEARTAGHMQTLADFRQLPARTLSTHWPP
QRSLCSSDFIRILVIFSGMFLVFTLAGALFLHQRRKYRSNKGESPVEPAEPCRYSCPREE
EGSTIPIQEDYRKPEPACSP
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggcacggccacatccctggtggctgtgcgttctggggaccctggtggggctctcagct
actccagcccccaagagctgcccagagaggcactactgggctcagggaaagctgtgctgc
cagatgtgtgagccaggaacattcctcgtgaaggactgtgaccagcatagaaaggctgct
cagtgtgatccttgcataccgggggtctccttctctcctgaccaccacacccggccccac
tgtgagagctgtcggcactgtaactctggtcttctcgttcgcaactgcaccatcactgcc
aatgctgagtgtgcctgtcgcaatggctggcagtgcagggacaaggagtgcaccgagtgt
gatcctcttccaaacccttcgctgaccgctcggtcgtctcaggccctgagcccacaccct
cagcccacccacttaccttatgtcagtgagatgctggaggccaggacagctgggcacatg
cagactctggctgacttcaggcagctgcctgcccggactctctctacccactggccaccc
caaagatccctgtgcagctccgattttattcgcatccttgtgatcttctctggaatgttc
cttgttttcaccctggccggggccctgttcctccatcaacgaaggaaatatagatcaaac
aaaggagaaagtcctgtggagcctgcagagccttgtcgttacagctgccccagggaggag
gagggcagcaccatccccatccaggaggattaccgaaaaccggagcctgcctgctccccc
tga

DBGET integrated database retrieval system