KEGG   Homo sapiens (human): 940Help
Entry
940               CDS       T01001                                 

Gene name
CD28, Tp44
Definition
(RefSeq) CD28 molecule
  KO
K06470  CD28 antigen
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules (CAMs)
hsa04660  T cell receptor signaling pathway
hsa04672  Intestinal immune network for IgA production
hsa04940  Type I diabetes mellitus
hsa05162  Measles
hsa05320  Autoimmune thyroid disease
hsa05322  Systemic lupus erythematosus
hsa05323  Rheumatoid arthritis
hsa05330  Allograft rejection
hsa05332  Graft-versus-host disease
hsa05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    940 (CD28)
 Organismal Systems
  Immune system
   04660 T cell receptor signaling pathway
    940 (CD28)
   04672 Intestinal immune network for IgA production
    940 (CD28)
 Human Diseases
  Immune diseases
   05322 Systemic lupus erythematosus
    940 (CD28)
   05323 Rheumatoid arthritis
    940 (CD28)
   05320 Autoimmune thyroid disease
    940 (CD28)
   05330 Allograft rejection
    940 (CD28)
   05332 Graft-versus-host disease
    940 (CD28)
  Cardiovascular diseases
   05416 Viral myocarditis
    940 (CD28)
  Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    940 (CD28)
  Infectious diseases
   05162 Measles
    940 (CD28)
Cell adhesion molecules and their ligands [BR:hsa04516]
 1. Immunoglobulin Superfamily
  Immune system
   B7-CD28 family
    CD80; CD80 antigen [KO:K05412]
     940 (CD28)
    CD86; CD86 antigen [KO:K05413]
     940 (CD28)
    ICOSLG, ICOSL; inducible T-cell co-stimulator ligand [KO:K06710]
     940 (CD28)
CD molecules [BR:hsa04090]
 Proteins
  940 (CD28)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: V-set_2 V-set
Motif
Other DBs
NCBI-GeneID: 940
NCBI-ProteinID: NP_006130
OMIM: 186760
HGNC: 1653
Ensembl: ENSG00000178562
Vega: OTTHUMG00000132878
Pharos: P10747(Tbio)
UniProt: P10747
Structure
PDB: 

Jmol
Position
2q33.2
AA seq 220 aa AA seqDB search
MLRLLLALNLFPSIQVTGNKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLD
SAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPP
PYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVR
SKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgctcaggctgctcttggctctcaacttattcccttcaattcaagtaacaggaaacaag
attttggtgaagcagtcgcccatgcttgtagcgtacgacaatgcggtcaaccttagctgc
aagtattcctacaatctcttctcaagggagttccgggcatcccttcacaaaggactggat
agtgctgtggaagtctgtgttgtatatgggaattactcccagcagcttcaggtttactca
aaaacggggttcaactgtgatgggaaattgggcaatgaatcagtgacattctacctccag
aatttgtatgttaaccaaacagatatttacttctgcaaaattgaagttatgtatcctcct
ccttacctagacaatgagaagagcaatggaaccattatccatgtgaaagggaaacacctt
tgtccaagtcccctatttcccggaccttctaagcccttttgggtgctggtggtggttggt
ggagtcctggcttgctatagcttgctagtaacagtggcctttattattttctgggtgagg
agtaagaggagcaggctcctgcacagtgactacatgaacatgactccccgccgccccggg
cccacccgcaagcattaccagccctatgccccaccacgcgacttcgcagcctatcgctcc
tga

DBGET integrated database retrieval system