KEGG   Homo sapiens (human): 940Help
Entry
940               CDS       T01001                                 

Gene name
CD28, Tp44
Definition
(RefSeq) CD28 molecule
  KO
K06470  
CD28 antigen
Organism
hsa  Homo sapiens (human)
Pathway
Cell adhesion molecules (CAMs)
T cell receptor signaling pathway
Intestinal immune network for IgA production
Type I diabetes mellitus
Measles
Autoimmune thyroid disease
Systemic lupus erythematosus
Rheumatoid arthritis
Allograft rejection
Graft-versus-host disease
Viral myocarditis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    940 (CD28)
 Organismal Systems
  Immune system
   04660 T cell receptor signaling pathway
    940 (CD28)
   04672 Intestinal immune network for IgA production
    940 (CD28)
 Human Diseases
  Immune diseases
   05322 Systemic lupus erythematosus
    940 (CD28)
   05323 Rheumatoid arthritis
    940 (CD28)
   05320 Autoimmune thyroid disease
    940 (CD28)
   05330 Allograft rejection
    940 (CD28)
   05332 Graft-versus-host disease
    940 (CD28)
  Cardiovascular diseases
   05416 Viral myocarditis
    940 (CD28)
  Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    940 (CD28)
  Infectious diseases
   05162 Measles
    940 (CD28)
Cell adhesion molecules and their ligands [BR:hsa04516]
 1. Immunoglobulin Superfamily
  Immune system
   B7-CD28 family
    CD80; CD80 antigen [KO:K05412]
     940 (CD28)
    CD86; CD86 antigen [KO:K05413]
     940 (CD28)
    ICOSLG, ICOSL; inducible T-cell co-stimulator ligand [KO:K06710]
     940 (CD28)
Cellular antigens [BR:hsa04090]
 Proteins
  940 (CD28)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P10747(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
2q33.2
AA seq 220 aa AA seqDB search
MLRLLLALNLFPSIQVTGNKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLD
SAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPP
PYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVR
SKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgctcaggctgctcttggctctcaacttattcccttcaattcaagtaacaggaaacaag
attttggtgaagcagtcgcccatgcttgtagcgtacgacaatgcggtcaaccttagctgc
aagtattcctacaatctcttctcaagggagttccgggcatcccttcacaaaggactggat
agtgctgtggaagtctgtgttgtatatgggaattactcccagcagcttcaggtttactca
aaaacggggttcaactgtgatgggaaattgggcaatgaatcagtgacattctacctccag
aatttgtatgttaaccaaacagatatttacttctgcaaaattgaagttatgtatcctcct
ccttacctagacaatgagaagagcaatggaaccattatccatgtgaaagggaaacacctt
tgtccaagtcccctatttcccggaccttctaagcccttttgggtgctggtggtggttggt
ggagtcctggcttgctatagcttgctagtaacagtggcctttattattttctgggtgagg
agtaagaggagcaggctcctgcacagtgactacatgaacatgactccccgccgccccggg
cccacccgcaagcattaccagccctatgccccaccacgcgacttcgcagcctatcgctcc
tga

DBGET integrated database retrieval system