KEGG   Homo sapiens (human): 94025Help
Entry
94025             CDS       T01001                                 

Gene name
MUC16, CA125
Definition
mucin 16, cell surface associated
Orthology
K16145  
mucin-16
Organism
hsa  Homo sapiens (human)
Drug target
Other: 
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Position
19p13.2
AA seq 14507 aa AA seqDB search
MLKPSGLPGSSSPTRSLMTGSRSTKATPEMDSGLTGATLSPKTSTGAIVVTEHTLPFTSP
DKTLASPTSSVVGRTTQSLGVMSSALPESTSRGMTHSEQRTSPSLSPQVNGTPSRNYPAT
SMVSGLSSPRTRTSSTEGNFTKEASTYTLTVETTSGPVTEKYTVPTETSTTEGDSTETPW
DTRYIPVKITSPMKTFADSTASKENAPVSMTPAETTVTDSHTPGRTNPSFGTLYSSFLDL
SPKGTPNSRGETSLELILSTTGYPFSSPEPGSAGHSRISTSAPLSSSASVLDNKISETSI
FSGQSLTSPLSPGVPEARASTMPNSAIPFSMTLSNAETSAERVRSTISSLGTPSISTKQT
AETILTFHAFAETMDIPSTHIAKTLASEWLGSPGTLGGTSTSALTTTSPSTTLVSEETNT
HHSTSGKETEGTLNTSMTPLETSAPGEESEMTATLVPTLGFTTLDSKIRSPSQVSSSHPT
RELRTTGSTSGRQSSSTAAHGSSDILRATTSSTSKASSWTSESTAQQFSEPQHTQWVETS
PSMKTERPPASTSVAAPITTSVPSVVSGFTTLKTSSTKGIWLEETSADTLIGESTAGPTT
HQFAVPTGISMTGGSSTRGSQGTTHLLTRATASSETSADLTLATNGVPVSVSPAVSKTAA
GSSPPGGTKPSYTMVSSVIPETSSLQSSAFREGTSLGLTPLNTRHPFSSPEPDSAGHTKI
STSIPLLSSASVLEDKVSATSTFSHHKATSSITTGTPEISTKTKPSSAVLSSMTLSNAAT
SPERVRNATSPLTHPSPSGEETAGSVLTLSTSAETTDSPNIHPTGTLTSESSESPSTLSL
PSVSGVKTTFSSSTPSTHLFTSGEETEETSNPSVSQPETSVSRVRTTLASTSVPTPVFPT
MDTWPTRSAQFSSSHLVSELRATSSTSVTNSTGSALPKISHLTGTATMSQTNRDTFNDSA
APQSTTWPETSPRFKTGLPSATTTVSTSATSLSATVMVSKFTSPATSSMEATSIREPSTT
ILTTETTNGPGSMAVASTNIPIGKGYITEGRLDTSHLPIGTTASSETSMDFTMAKESVSM
SVSPSQSMDAAGSSTPGRTSQFVDTFSDDVYHLTSREITIPRDGTSSALTPQMTATHPPS
PDPGSARSTWLGILSSSPSSPTPKVTMSSTFSTQRVTTSMIMDTVETSRWNMPNLPSTTS
LTPSNIPTSGAIGKSTLVPLDTPSPATSLEASEGGLPTLSTYPESTNTPSIHLGAHASSE
SPSTIKLTMASVVKPGSYTPLTFPSIETHIHVSTARMAYSSGSSPEMTAPGETNTGSTWD
PTTYITTTDPKDTSSAQVSTPHSVRTLRTTENHPKTESATPAAYSGSPKISSSPNLTSPA
TKAWTITDTTEHSTQLHYTKLAEKSSGFETQSAPGPVSVVIPTSPTIGSSTLELTSDVPG
EPLVLAPSEQTTITLPMATWLSTSLTEEMASTDLDISSPSSPMSTFAIFPPMSTPSHELS
KSEADTSAIRNTDSTTLDQHLGIRSLGRTGDLTTVPITPLTTTWTSVIEHSTQAQDTLSA
TMSPTHVTQSLKDQTSIPASASPSHLTEVYPELGTQGRSSSEATTFWKPSTDTLSREIET
GPTNIQSTPPMDNTTTGSSSSGVTLGIAHLPIGTSSPAETSTNMALERRSSTATVSMAGT
MGLLVTSAPGRSISQSLGRVSSVLSESTTEGVTDSSKGSSPRLNTQGNTALSSSLEPSYA
EGSQMSTSIPLTSSPTTPDVEFIGGSTFWTKEVTTVMTSDISKSSARTESSSATLMSTAL
GSTENTGKEKLRTASMDLPSPTPSMEVTPWISLTLSNAPNTTDSLDLSHGVHTSSAGTLA
TDRSLNTGVTRASRLENGSDTSSKSLSMGNSTHTSMTYTEKSEVSSSIHPRPETSAPGAE
TTLTSTPGNRAISLTLPFSSIPVEEVISTGITSGPDINSAPMTHSPITPPTIVWTSTGTI
EQSTQPLHAVSSEKVSVQTQSTPYVNSVAVSASPTHENSVSSGSSTSSPYSSASLESLDS
TISRRNAITSWLWDLTTSLPTTTWPSTSLSEALSSGHSGVSNPSSTTTEFPLFSAASTSA
AKQRNPETETHGPQNTAASTLNTDASSVTGLSETPVGASISSEVPLPMAITSRSDVSGLT
SESTANPSLGTASSAGTKLTRTISLPTSESLVSFRMNKDPWTVSIPLGSHPTTNTETSIP
VNSAGPPGLSTVASDVIDTPSDGAESIPTVSFSPSPDTEVTTISHFPEKTTHSFRTISSL
THELTSRVTPIPGDWMSSAMSTKPTGASPSITLGERRTITSAAPTTSPIVLTASFTETST
VSLDNETTVKTSDILDARKTNELPSDSSSSSDLINTSIASSTMDVTKTASISPTSISGMT
ASSSPSLFSSDRPQVPTSTTETNTATSPSVSSNTYSLDGGSNVGGTPSTLPPFTITHPVE
TSSALLAWSRPVRTFSTMVSTDTASGENPTSSNSVVTSVPAPGTWTSVGSTTDLPAMGFL
KTSPAGEAHSLLASTIEPATAFTPHLSAAVVTGSSATSEASLLTTSESKAIHSSPQTPTT
PTSGANWETSATPESLLVVTETSDTTLTSKILVTDTILFSTVSTPPSKFPSTGTLSGASF
PTLLPDTPAIPLTATEPTSSLATSFDSTPLVTIASDSLGTVPETTLTMSETSNGDALVLK
TVSNPDRSIPGITIQGVTESPLHPSSTSPSKIVAPRNTTYEGSITVALSTLPAGTTGSLV
FSQSSENSETTALVDSSAGLERASVMPLTTGSQGMASSGGIRSGSTHSTGTKTFSSLPLT
MNPGEVTAMSEITTNRLTATQSTAPKGIPVKPTSAESGLLTPVSASSSPSKAFASLTTAP
PTWGIPQSTLTFEFSEVPSLDTKSASLPTPGQSLNTIPDSDASTASSSLSKSPEKNPRAR
MMTSTKAISASSFQSTGFTETPEGSASPSMAGHEPRVPTSGTGDPRYASESMSYPDPSKA
SSAMTSTSLASKLTTLFSTGQAARSGSSSSPISLSTEKETSFLSPTASTSRKTSLFLGPS
MARQPNILVHLQTSALTLSPTSTLNMSQEEPPELTSSQTIAEEEGTTAETQTLTFTPSET
PTSLLPVSSPTEPTARRKSSPETWASSISVPAKTSLVETTDGTLVTTIKMSSQAAQGNST
WPAPAEETGSSPAGTSPGSPEMSTTLKIMSSKEPSISPEIRSTVRNSPWKTPETTVPMET
TVEPVTLQSTALGSGSTSISHLPTGTTSPTKSPTENMLATERVSLSPSPPEAWTNLYSGT
PGGTRQSLATMSSVSLESPTARSITGTGQQSSPELVSKTTGMEFSMWHGSTGGTTGDTHV
SLSTSSNILEDPVTSPNSVSSLTDKSKHKTETWVSTTAIPSTVLNNKIMAAEQQTSRSVD
EAYSSTSSWSDQTSGSDITLGASPDVTNTLYITSTAQTTSLVSLPSGDQGITSLTNPSGG
KTSSASSVTSPSIGLETLRANVSAVKSDIAPTAGHLSQTSSPAEVSILDVTTAPTPGIST
TITTMGTNSISTTTPNPEVGMSTMDSTPATERRTTSTEHPSTWSSTAASDSWTVTDMTSN
LKVARSPGTISTMHTTSFLASSTELDSMSTPHGRITVIGTSLVTPSSDASAVKTETSTSE
RTLSPSDTTASTPISTFSRVQRMSISVPDILSTSWTPSSTEAEDVPVSMVSTDHASTKTD
PNTPLSTFLFDSLSTLDWDTGRSLSSATATTSAPQGATTPQELTLETMISPATSQLPFSI
GHITSAVTPAAMARSSGVTFSRPDPTSKKAEQTSTQLPTTTSAHPGQVPRSAATTLDVIP
HTAKTPDATFQRQGQTALTTEARATSDSWNEKEKSTPSAPWITEMMNSVSEDTIKEVTSS
SSVLRTLNTLDINLESGTTSSPSWKSSPYERIAPSESTTDKEAIHPSTNTVETTGWVTSS
EHASHSTIPAHSASSKLTSPVVTTSTREQAIVSMSTTTWPESTRARTEPNSFLTIELRDV
SPYMDTSSTTQTSIISSPGSTAITKGPRTEITSSKRISSSFLAQSMRSSDSPSEAITRLS
NFPAMTESGGMILAMQTSPPGATSLSAPTLDTSATASWTGTPLATTQRFTYSEKTTLFSK
GPEDTSQPSPPSVEETSSSSSLVPIHATTSPSNILLTSQGHSPSSTPPVTSVFLSETSGL
GKTTDMSRISLEPGTSLPPNLSSTAGEALSTYEASRDTKAIHHSADTAVTNMEATSSEYS
PIPGHTKPSKATSPLVTSHIMGDITSSTSVFGSSETTEIETVSSVNQGLQERSTSQVASS
ATETSTVITHVSSGDATTHVTKTQATFSSGTSISSPHQFITSTNTFTDVSTNPSTSLIMT
ESSGVTITTQTGPTGAATQGPYLLDTSTMPYLTETPLAVTPDFMQSEKTTLISKGPKDVS
WTSPPSVAETSYPSSLTPFLVTTIPPATSTLQGQHTSSPVSATSVLTSGLVKTTDMLNTS
MEPVTNSPQNLNNPSNEILATLAATTDIETIHPSINKAVTNMGTASSAHVLHSTLPVSSE
PSTATSPMVPASSMGDALASISIPGSETTDIEGEPTSSLTAGRKENSTLQEMNSTTESNI
ILSNVSVGAITEATKMEVPSFDATFIPTPAQSTKFPDIFSVASSRLSNSPPMTISTHMTT
TQTGSSGATSKIPLALDTSTLETSAGTPSVVTEGFAHSKITTAMNNDVKDVSQTNPPFQD
EASSPSSQAPVLVTTLPSSVAFTPQWHSTSSPVSMSSVLTSSLVKTAGKVDTSLETVTSS
PQSMSNTLDDISVTSAATTDIETTHPSINTVVTNVGTTGSAFESHSTVSAYPEPSKVTSP
NVTTSTMEDTTISRSIPKSSKTTRTETETTSSLTPKLRETSISQEITSSTETSTVPYKEL
TGATTEVSRTDVTSSSSTSFPGPDQSTVSLDISTETNTRLSTSPIMTESAEITITTQTGP
HGATSQDTFTMDPSNTTPQAGIHSAMTHGFSQLDVTTLMSRIPQDVSWTSPPSVDKTSSP
SSFLSSPAMTTPSLISSTLPEDKLSSPMTSLLTSGLVKITDILRTRLEPVTSSLPNFSST
SDKILATSKDSKDTKEIFPSINTEETNVKANNSGHESHSPALADSETPKATTQMVITTTV
GDPAPSTSMPVHGSSETTNIKREPTYFLTPRLRETSTSQESSFPTDTSFLLSKVPTGTIT
EVSSTGVNSSSKISTPDHDKSTVPPDTFTGEIPRVFTSSIKTKSAEMTITTQASPPESAS
HSTLPLDTSTTLSQGGTHSTVTQGFPYSEVTTLMGMGPGNVSWMTTPPVEETSSVSSLMS
SPAMTSPSPVSSTSPQSIPSSPLPVTALPTSVLVTTTDVLGTTSPESVTSSPPNLSSITH
ERPATYKDTAHTEAAMHHSTNTAVTNVGTSGSGHKSQSSVLADSETSKATPLMSTTSTLG
DTSVSTSTPNISQTNQIQTEPTASLSPRLRESSTSEKTSSTTETNTAFSYVPTGAITQAS
RTEISSSRTSISDLDRPTIAPDISTGMITRLFTSPIMTKSAEMTVTTQTTTPGATSQGIL
PWDTSTTLFQGGTHSTVSQGFPHSEITTLRSRTPGDVSWMTTPPVEETSSGFSLMSPSMT
SPSPVSSTSPESIPSSPLPVTALLTSVLVTTTNVLGTTSPEPVTSSPPNLSSPTQERLTT
YKDTAHTEAMHASMHTNTAVANVGTSISGHESQSSVPADSHTSKATSPMGITFAMGDTSV
STSTPAFFETRIQTESTSSLIPGLRDTRTSEEINTVTETSTVLSEVPTTTTTEVSRTEVI
TSSRTTISGPDHSKMSPYISTETITRLSTFPFVTGSTEMAITNQTGPIGTISQATLTLDT
SSTASWEGTHSPVTQRFPHSEETTTMSRSTKGVSWQSPPSVEETSSPSSPVPLPAITSHS
SLYSAVSGSSPTSALPVTSLLTSGRRKTIDMLDTHSELVTSSLPSASSFSGEILTSEAST
NTETIHFSENTAETNMGTTNSMHKLHSSVSIHSQPSGHTPPKVTGSMMEDAIVSTSTPGS
PETKNVDRDSTSPLTPELKEDSTALVMNSTTESNTVFSSVSLDAATEVSRAEVTYYDPTF
MPASAQSTKSPDISPEASSSHSNSPPLTISTHKTIATQTGPSGVTSLGQLTLDTSTIATS
AGTPSARTQDFVDSETTSVMNNDLNDVLKTSPFSAEEANSLSSQAPLLVTTSPSPVTSTL
QEHSTSSLVSVTSVPTPTLAKITDMDTNLEPVTRSPQNLRNTLATSEATTDTHTMHPSIN
TAVANVGTTSSPNEFYFTVSPDSDPYKATSAVVITSTSGDSIVSTSMPRSSAMKKIESET
TFSLIFRLRETSTSQKIGSSSDTSTVFDKAFTAATTEVSRTELTSSSRTSIQGTEKPTMS
PDTSTRSVTMLSTFAGLTKSEERTIATQTGPHRATSQGTLTWDTSITTSQAGTHSAMTHG
FSQLDLSTLTSRVPEYISGTSPPSVEKTSSSSSLLSLPAITSPSPVPTTLPESRPSSPVH
LTSLPTSGLVKTTDMLASVASLPPNLGSTSHKIPTTSEDIKDTEKMYPSTNIAVTNVGTT
TSEKESYSSVPAYSEPPKVTSPMVTSFNIRDTIVSTSMPGSSEITRIEMESTFSLAHGLK
GTSTSQDPIVSTEKSAVLHKLTTGATETSRTEVASSRRTSIPGPDHSTESPDISTEVIPS
LPISLGITESSNMTIITRTGPPLGSTSQGTFTLDTPTTSSRAGTHSMATQEFPHSEMTTV
MNKDPEILSWTIPPSIEKTSFSSSLMPSPAMTSPPVSSTLPKTIHTTPSPMTSLLTPSLV
MTTDTLGTSPEPTTSSPPNLSSTSHEILTTDEDTTAIEAMHPSTSTAATNVETTSSGHGS
QSSVLADSEKTKATAPMDTTSTMGHTTVSTSMSVSSETTKIKRESTYSLTPGLRETSISQ
NASFSTDTSIVLSEVPTGTTAEVSRTEVTSSGRTSIPGPSQSTVLPEISTRTMTRLFASP
TMTESAEMTIPTQTGPSGSTSQDTLTLDTSTTKSQAKTHSTLTQRFPHSEMTTLMSRGPG
DMSWQSSPSLENPSSLPSLLSLPATTSPPPISSTLPVTISSSPLPVTSLLTSSPVTTTDM
LHTSPELVTSSPPKLSHTSDERLTTGKDTTNTEAVHPSTNTAASNVEIPSSGHESPSSAL
ADSETSKATSPMFITSTQEDTTVAISTPHFLETSRIQKESISSLSPKLRETGSSVETSSA
IETSAVLSEVSIGATTEISRTEVTSSSRTSISGSAESTMLPEISTTRKIIKFPTSPILAE
SSEMTIKTQTSPPGSTSESTFTLDTSTTPSLVITHSTMTQRLPHSEITTLVSRGAGDVPR
PSSLPVEETSPPSSQLSLSAMISPSPVSSTLPASSHSSSASVTSLLTPGQVKTTEVLDAS
AEPETSSPPSLSSTSVEILATSEVTTDTEKIHPFSNTAVTKVGTSSSGHESPSSVLPDSE
TTKATSAMGTISIMGDTSVSTLTPALSNTRKIQSEPASSLTTRLRETSTSEETSLATEAN
TVLSKVSTGATTEVSRTEAISFSRTSMSGPEQSTMSQDISIGTIPRISASSVLTESAKMT
ITTQTGPSESTLESTLNLNTATTPSWVETHSIVIQGFPHPEMTTSMGRGPGGVSWPSPPF
VKETSPPSSPLSLPAVTSPHPVSTTFLAHIPPSPLPVTSLLTSGPATTTDILGTSTEPGT
SSSSSLSTTSHERLTTYKDTAHTEAVHPSTNTGGTNVATTSSGYKSQSSVLADSSPMCTT
STMGDTSVLTSTPAFLETRRIQTELASSLTPGLRESSGSEGTSSGTKMSTVLSKVPTGAT
TEISKEDVTSIPGPAQSTISPDISTRTVSWFSTSPVMTESAEITMNTHTSPLGATTQGTS
TLDTSSTTSLTMTHSTISQGFSHSQMSTLMRRGPEDVSWMSPPLLEKTRPSFSLMSSPAT
TSPSPVSSTLPESISSSPLPVTSLLTSGLAKTTDMLHKSSEPVTNSPANLSSTSVEILAT
SEVTTDTEKTHPSSNRTVTDVGTSSSGHESTSFVLADSQTSKVTSPMVITSTMEDTSVST
STPGFFETSRIQTEPTSSLTLGLRKTSSSEGTSLATEMSTVLSGVPTGATAEVSRTEVTS
SSRTSISGFAQLTVSPETSTETITRLPTSSIMTESAEMMIKTQTDPPGSTPESTHTVDIS
TTPNWVETHSTVTQRFSHSEMTTLVSRSPGDMLWPSQSSVEETSSASSLLSLPATTSPSP
VSSTLVEDFPSASLPVTSLLNPGLVITTDRMGISREPGTSSTSNLSSTSHERLTTLEDTV
DTEDMQPSTHTAVTNVRTSISGHESQSSVLSDSETPKATSPMGTTYTMGETSVSISTSDF
FETSRIQIEPTSSLTSGLRETSSSERISSATEGSTVLSEVPSGATTEVSRTEVISSRGTS
MSGPDQFTISPDISTEAITRLSTSPIMTESAESAITIETGSPGATSEGTLTLDTSTTTFW
SGTHSTASPGFSHSEMTTLMSRTPGDVPWPSLPSVEEASSVSSSLSSPAMTSTSFFSTLP
ESISSSPHPVTALLTLGPVKTTDMLRTSSEPETSSPPNLSSTSAEILATSEVTKDREKIH
PSSNTPVVNVGTVIYKHLSPSSVLADLVTTKPTSPMATTSTLGNTSVSTSTPAFPETMMT
QPTSSLTSGLREISTSQETSSATERSASLSGMPTGATTKVSRTEALSLGRTSTPGPAQST
ISPEISTETITRISTPLTTTGSAEMTITPKTGHSGASSQGTFTLDTSSRASWPGTHSAAT
HRSPHSGMTTPMSRGPEDVSWPSRPSVEKTSPPSSLVSLSAVTSPSPLYSTPSESSHSSP
LRVTSLFTPVMMKTTDMLDTSLEPVTTSPPSMNITSDESLATSKATMETEAIQLSENTAV
TQMGTISARQEFYSSYPGLPEPSKVTSPVVTSSTIKDIVSTTIPASSEITRIEMESTSTL
TPTPRETSTSQEIHSATKPSTVPYKALTSATIEDSMTQVMSSSRGPSPDQSTMSQDISTE
VITRLSTSPIKTESTEMTITTQTGSPGATSRGTLTLDTSTTFMSGTHSTASQGFSHSQMT
ALMSRTPGDVPWLSHPSVEEASSASFSLSSPVMTSSSPVSSTLPDSIHSSSLPVTSLLTS
GLVKTTELLGTSSEPETSSPPNLSSTSAEILAITEVTTDTEKLEMTNVVTSGYTHESPSS
VLADSVTTKATSSMGITYPTGDTNVLTSTPAFSDTSRIQTKSKLSLTPGLMETSISEETS
SATEKSTVLSSVPTGATTEVSRTEAISSSRTSIPGPAQSTMSSDTSMETITRISTPLTRK
ESTDMAITPKTGPSGATSQGTFTLDSSSTASWPGTHSATTQRFPQSVVTTPMSRGPEDVS
WPSPLSVEKNSPPSSLVSSSSVTSPSPLYSTPSGSSHSSPVPVTSLFTSIMMKATDMLDA
SLEPETTSAPNMNITSDESLAASKATTETEAIHVFENTAASHVETTSATEELYSSSPGFS
EPTKVISPVVTSSSIRDNMVSTTMPGSSGITRIEIESMSSLTPGLRETRTSQDITSSTET
STVLYKMPSGATPEVSRTEVMPSSRTSIPGPAQSTMSLDISDEVVTRLSTSPIMTESAEI
TITTQTGYSLATSQVTLPLGTSMTFLSGTHSTMSQGLSHSEMTNLMSRGPESLSWTSPRF
VETTRSSSSLTSLPLTTSLSPVSSTLLDSSPSSPLPVTSLILPGLVKTTEVLDTSSEPKT
SSSPNLSSTSVEIPATSEIMTDTEKIHPSSNTAVAKVRTSSSVHESHSSVLADSETTITI
PSMGITSAVDDTTVFTSNPAFSETRRIPTEPTFSLTPGFRETSTSEETTSITETSAVLYG
VPTSATTEVSMTEIMSSNRIHIPDSDQSTMSPDIITEVITRLSSSSMMSESTQMTITTQK
SSPGATAQSTLTLATTTAPLARTHSTVPPRFLHSEMTTLMSRSPENPSWKSSLFVEKTSS
SSSLLSLPVTTSPSVSSTLPQSIPSSSFSVTSLLTPGMVKTTDTSTEPGTSLSPNLSGTS
VEILAASEVTTDTEKIHPSSSMAVTNVGTTSSGHELYSSVSIHSEPSKATYPVGTPSSMA
ETSISTSMPANFETTGFEAEPFSHLTSGFRKTNMSLDTSSVTPTNTPSSPGSTHLLQSSK
TDFTSSAKTSSPDWPPASQYTEIPVDIITPFNASPSITESTGITSFPESRFTMSVTESTH
HLSTDLLPSAETISTGTVMPSLSEAMTSFATTGVPRAISGSGSPFSRTESGPGDATLSTI
AESLPSSTPVPFSSSTFTTTDSSTIPALHEITSSSATPYRVDTSLGTESSTTEGRLVMVS
TLDTSSQPGRTSSSPILDTRMTESVELGTVTSAYQVPSLSTRLTRTDGIMEHITKIPNEA
AHRGTIRPVKGPQTSTSPASPKGLHTGGTKRMETTTTALKTTTTALKTTSRATLTTSVYT
PTLGTLTPLNASMQMASTIPTEMMITTPYVFPDVPETTSSLATSLGAETSTALPRTTPSV
FNRESETTASLVSRSGAERSPVIQTLDVSSSEPDTTASWVIHPAETIPTVSKTTPNFFHS
ELDTVSSTATSHGADVSSAIPTNISPSELDALTPLVTISGTDTSTTFPTLTKSPHETETR
TTWLTHPAETSSTIPRTIPNFSHHESDATPSIATSPGAETSSAIPIMTVSPGAEDLVTSQ
VTSSGTDRNMTIPTLTLSPGEPKTIASLVTHPEAQTSSAIPTSTISPAVSRLVTSMVTSL
AAKTSTTNRALTNSPGEPATTVSLVTHPAQTSPTVPWTTSIFFHSKSDTTPSMTTSHGAE
SSSAVPTPTVSTEVPGVVTPLVTSSRAVISTTIPILTLSPGEPETTPSMATSHGEEASSA
IPTPTVSPGVPGVVTSLVTSSRAVTSTTIPILTFSLGEPETTPSMATSHGTEAGSAVPTV
LPEVPGMVTSLVASSRAVTSTTLPTLTLSPGEPETTPSMATSHGAEASSTVPTVSPEVPG
VVTSLVTSSSGVNSTSIPTLILSPGELETTPSMATSHGAEASSAVPTPTVSPGVSGVVTP
LVTSSRAVTSTTIPILTLSSSEPETTPSMATSHGVEASSAVLTVSPEVPGMVTSLVTSSR
AVTSTTIPTLTISSDEPETTTSLVTHSEAKMISAIPTLAVSPTVQGLVTSLVTSSGSETS
AFSNLTVASSQPETIDSWVAHPGTEASSVVPTLTVSTGEPFTNISLVTHPAESSSTLPRT
TSRFSHSELDTMPSTVTSPEAESSSAISTTISPGIPGVLTSLVTSSGRDISATFPTVPES
PHESEATASWVTHPAVTSTTVPRTTPNYSHSEPDTTPSIATSPGAEATSDFPTITVSPDV
PDMVTSQVTSSGTDTSITIPTLTLSSGEPETTTSFITYSETHTSSAIPTLPVSPGASKML
TSLVISSGTDSTTTFPTLTETPYEPETTAIQLIHPAETNTMVPRTTPKFSHSKSDTTLPV
AITSPGPEASSAVSTTTISPDMSDLVTSLVPSSGTDTSTTFPTLSETPYEPETTATWLTH
PAETSTTVSGTIPNFSHRGSDTAPSMVTSPGVDTRSGVPTTTIPPSIPGVVTSQVTSSAT
DTSTAIPTLTPSPGEPETTASSATHPGTQTGFTVPIRTVPSSEPDTMASWVTHPPQTSTP
VSRTTSSFSHSSPDATPVMATSPRTEASSAVLTTISPGAPEMVTSQITSSGAATSTTVPT
LTHSPGMPETTALLSTHPRTETSKTFPASTVFPQVSETTASLTIRPGAETSTALPTQTTS
SLFTLLVTGTSRVDLSPTASPGVSAKTAPLSTHPGTETSTMIPTSTLSLGLLETTGLLAT
SSSAETSTSTLTLTVSPAVSGLSSASITTDKPQTVTSWNTETSPSVTSVGPPEFSRTVTG
TTMTLIPSEMPTPPKTSHGEGVSPTTILRTTMVEATNLATTGSSPTVAKTTTTFNTLAGS
LFTPLTTPGMSTLASESVTSRTSYNHRSWISTTSSYNRRYWTPATSTPVTSTFSPGISTS
SIPSSTAATVPFMVPFTLNFTITNLQYEEDMRHPGSRKFNATERELQGLLKPLFRNSSLE
YLYSGCRLASLRPEKDSSATAVDAICTHRPDPEDLGLDRERLYWELSNLTNGIQELGPYT
LDRNSLYVNGFTHRSSMPTTSTPGTSTVDVGTSGTPSSSPSPTTAGPLLMPFTLNFTITN
LQYEEDMRRTGSRKFNTMESVLQGLLKPLFKNTSVGPLYSGCRLTLLRPEKDGAATGVDA
ICTHRLDPKSPGLNREQLYWELSKLTNDIEELGPYTLDRNSLYVNGFTHQSSVSTTSTPG
TSTVDLRTSGTPSSLSSPTIMAAGPLLVPFTLNFTITNLQYGEDMGHPGSRKFNTTERVL
QGLLGPIFKNTSVGPLYSGCRLTSLRSEKDGAATGVDAICIHHLDPKSPGLNRERLYWEL
SQLTNGIKELGPYTLDRNSLYVNGFTHRTSVPTSSTPGTSTVDLGTSGTPFSLPSPATAG
PLLVLFTLNFTITNLKYEEDMHRPGSRKFNTTERVLQTLLGPMFKNTSVGLLYSGCRLTL
LRSEKDGAATGVDAICTHRLDPKSPGVDREQLYWELSQLTNGIKELGPYTLDRNSLYVNG
FTHWIPVPTSSTPGTSTVDLGSGTPSSLPSPTTAGPLLVPFTLNFTITNLKYEEDMHCPG
SRKFNTTERVLQSLLGPMFKNTSVGPLYSGCRLTLLRSEKDGAATGVDAICTHRLDPKSP
GVDREQLYWELSQLTNGIKELGPYTLDRNSLYVNGFTHQTSAPNTSTPGTSTVDLGTSGT
PSSLPSPTSAGPLLVPFTLNFTITNLQYEEDMHHPGSRKFNTTERVLQGLLGPMFKNTSV
GLLYSGCRLTLLRPEKNGAATGMDAICSHRLDPKSPGLNREQLYWELSQLTHGIKELGPY
TLDRNSLYVNGFTHRSSVAPTSTPGTSTVDLGTSGTPSSLPSPTTAVPLLVPFTLNFTIT
NLQYGEDMRHPGSRKFNTTERVLQGLLGPLFKNSSVGPLYSGCRLISLRSEKDGAATGVD
AICTHHLNPQSPGLDREQLYWQLSQMTNGIKELGPYTLDRNSLYVNGFTHRSSGLTTSTP
WTSTVDLGTSGTPSPVPSPTTTGPLLVPFTLNFTITNLQYEENMGHPGSRKFNITESVLQ
GLLKPLFKSTSVGPLYSGCRLTLLRPEKDGVATRVDAICTHRPDPKIPGLDRQQLYWELS
QLTHSITELGPYTLDRDSLYVNGFTQRSSVPTTSTPGTFTVQPETSETPSSLPGPTATGP
VLLPFTLNFTITNLQYEEDMRRPGSRKFNTTERVLQGLLMPLFKNTSVSSLYSGCRLTLL
RPEKDGAATRVDAVCTHRPDPKSPGLDRERLYWKLSQLTHGITELGPYTLDRHSLYVNGF
THQSSMTTTRTPDTSTMHLATSRTPASLSGPMTASPLLVLFTINFTITNLRYEENMHHPG
SRKFNTTERVLQGLLRPVFKNTSVGPLYSGCRLTLLRPKKDGAATKVDAICTYRPDPKSP
GLDREQLYWELSQLTHSITELGPYTLDRDSLYVNGFTQRSSVPTTSIPGTPTVDLGTSGT
PVSKPGPSAASPLLVLFTLNFTITNLRYEENMQHPGSRKFNTTERVLQGLLRSLFKSTSV
GPLYSGCRLTLLRPEKDGTATGVDAICTHHPDPKSPRLDREQLYWELSQLTHNITELGPY
ALDNDSLFVNGFTHRSSVSTTSTPGTPTVYLGASKTPASIFGPSAASHLLILFTLNFTIT
NLRYEENMWPGSRKFNTTERVLQGLLRPLFKNTSVGPLYSGCRLTLLRPEKDGEATGVDA
ICTHRPDPTGPGLDREQLYLELSQLTHSITELGPYTLDRDSLYVNGFTHRSSVPTTSTGV
VSEEPFTLNFTINNLRYMADMGQPGSLKFNITDNVMQHLLSPLFQRSSLGARYTGCRVIA
LRSVKNGAETRVDLLCTYLQPLSGPGLPIKQVFHELSQQTHGITRLGPYSLDKDSLYLNG
YNEPGPDEPPTTPKPATTFLPPLSEATTAMGYHLKTLTLNFTISNLQYSPDMGKGSATFN
STEGVLQHLLRPLFQKSSMGPFYLGCQLISLRPEKDGAATGVDTTCTYHPDPVGPGLDIQ
QLYWELSQLTHGVTQLGFYVLDRDSLFINGYAPQNLSIRGEYQINFHIVNWNLSNPDPTS
SEYITLLRDIQDKVTTLYKGSQLHDTFRFCLVTNLTMDSVLVTVKALFSSNLDPSLVEQV
FLDKTLNASFHWLGSTYQLVDIHVTEMESSVYQPTSSSSTQHFYLNFTITNLPYSQDKAQ
PGTTNYQRNKRNIEDALNQLFRNSSIKSYFSDCQVSTFRSVPNRHHTGVDSLCNFSPLAR
RVDRVAIYEEFLRMTRNGTQLQNFTLDRSSVLVDGYSPNRNEPLTGNSDLPFWAVILIGL
AGLLGVITCLICGVLVTTRRRKKEGEYNVQQQCPGYYQSHLDLEDLQ
NT seq 43524 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaaccctcaggccttcctgggtcatcttctcccacccgctccttgatgacaggg
agcaggagcactaaagccacaccagaaatggattcaggactgacaggagccaccttgtca
cctaagacatctacaggtgcaatcgtggtgacagaacatactctgccctttacttcccca
gataagaccttggccagtcctacatcttcggttgtgggaagaaccacccagtctttgggg
gtgatgtcctctgctctccctgagtcaacctctagaggaatgacacactccgagcaaaga
accagcccatcgctgagtccccaggtcaatggaactccctctaggaactaccctgctaca
agcatggtttcaggattgagttccccaaggaccaggaccagttccacagaaggaaatttt
accaaagaagcatctacatacacactcactgtagagaccacaagtggcccagtcactgag
aagtacacagtccccactgagacctcaacaactgaaggtgacagcacagagaccccctgg
gacacaagatatattcctgtaaaaatcacatctccaatgaaaacatttgcagattcaact
gcatccaaggaaaatgccccagtgtctatgactccagctgagaccacagttactgactca
catactccaggaaggacaaacccatcatttgggacactttattcttccttccttgaccta
tcacctaaagggaccccaaattccagaggtgaaacaagcctggaactgattctatcaacc
actggatatcccttctcctctcctgaacctggctctgcaggacacagcagaataagtacc
agtgcgcctttgtcatcatctgcttcagttctcgataataaaatatcagagaccagcata
ttctcaggccagagtctcacctcccctctgtctcctggggtgcccgaggccagagccagc
acaatgcccaactcagctatccctttttccatgacactaagcaatgcagaaacaagtgcc
gaaagggtcagaagcacaatttcctctctggggactccatcaatatccacaaagcagaca
gcagagactatccttaccttccatgccttcgctgagaccatggatatacccagcacccac
atagccaagactttggcttcagaatggttgggaagtccaggtacccttggtggcaccagc
acttcagcgctgacaaccacatctccatctaccactttagtctcagaggagaccaacacc
catcactccacgagtggaaaggaaacagaaggaactttgaatacatctatgactccactt
gagacctctgctcctggagaagagtccgaaatgactgccaccttggtccccactctaggt
tttacaactcttgacagcaagatcagaagtccatctcaggtctcttcatcccacccaaca
agagagctcagaaccacaggcagcacctctgggaggcagagttccagcacagctgcccac
gggagctctgacatcctgagggcaaccacttccagcacctcaaaagcatcatcatggacc
agtgaaagcacagctcagcaatttagtgaaccccagcacacacagtgggtggagacaagt
cctagcatgaaaacagagagacccccagcatcaaccagtgtggcagcccctatcaccact
tctgttccctcagtggtctctggcttcaccaccctgaagaccagctccacaaaagggatt
tggcttgaagaaacatctgcagacacactcatcggagaatccacagctggcccaaccacc
catcagtttgctgttcccactgggatttcaatgacaggaggcagcagcaccaggggaagc
cagggcacaacccacctactcaccagagccacagcatcatctgagacatccgcagatttg
actctggccacgaacggtgtcccagtctccgtgtctccagcagtgagcaagacggctgct
ggctcaagtcctccaggagggacaaagccatcatatacaatggtttcttctgtcatccct
gagacatcatctctacagtcctcagctttcagggaaggaaccagcctgggactgactcca
ttaaacactagacatcccttctcttcccctgaaccagactctgcaggacacaccaagata
agcaccagcattcctctgttgtcatctgcttcagttcttgaggataaagtgtcagcgacc
agcacattctcacaccacaaagccacctcatctattaccacagggactcctgaaatctca
acaaagacaaagcccagctcagccgttctttcctccatgaccctaagcaatgcagcaaca
agtcctgaaagagtcagaaatgcaacttcccctctgactcatccatctccatcaggggaa
gagacagcagggagtgtcctcactctcagcacctctgctgagactacagactcacctaac
atccacccaactgggacactgacttcagaatcgtcagagagtcctagcactctcagcctc
ccaagtgtctctggagtcaaaaccacattttcttcatctactccttccactcatctattt
actagtggagaagaaacagaggaaacttcgaatccatctgtgtctcaacctgagacttct
gtttccagagtaaggaccaccttggccagcacctctgtccctaccccagtattccccacc
atggacacctggcctacacgttcagctcagttctcttcatcccacctagtgagtgagctc
agagctacgagcagtacctcagttacaaactcaactggttcagctcttcctaaaatatct
cacctcactgggacggcaacaatgtcacagaccaatagagacacgtttaatgactctgct
gcaccccaaagcacaacttggccagagactagtcccagattcaagacagggttaccttca
gcaacaaccactgtttcaacctctgccacttctctctctgctactgtaatggtctctaaa
ttcacttctccagcaactagttccatggaagcaacttctatcagggaaccatcaacaacc
atcctcacaacagagaccacgaatggcccaggctctatggctgtggcttctaccaacatc
ccaattggaaagggctacattactgaaggaagattggacacaagccatctgcccattgga
accacagcttcctctgagacatctatggattttaccatggccaaagaaagtgtctcaatg
tcagtatctccatctcagtccatggatgctgctggctcaagcactccaggaaggacaagc
caattcgttgacacattttctgatgatgtctatcatttaacatccagagaaattacaata
cctagagatggaacaagctcagctctgactccacaaatgactgcaactcaccctccatct
cctgatcctggctctgctagaagcacctggcttggcatcttgtcctcatctccttcttct
cctactcccaaagtcacaatgagctccacattttcaactcagagagtcaccacaagcatg
ataatggacacagttgaaactagtcggtggaacatgcccaacttaccttccacgacttcc
ttgacaccaagtaatattccaacaagtggtgccataggaaaaagcaccctggttcccttg
gacactccatctccagccacatcattggaggcatcagaagggggacttccaaccctcagc
acctaccctgaatcaacaaacacacccagcatccacctcggagcacacgctagttcagaa
agtccaagcaccatcaaacttaccatggcttcagtagtaaaacctggctcttacacacct
ctcaccttcccctcaatagagacccacattcatgtatcaacagccagaatggcttactct
tctgggtcttcacctgagatgacagctcctggagagactaacactggtagtacctgggac
cccaccacctacatcaccactacggatcctaaggatacaagttcagctcaggtctctaca
ccccactcagtgaggacactcagaaccacagaaaaccatccaaagacagagtccgccacc
ccagctgcttactctggaagtcctaaaatctcaagttcacccaatctcaccagtccggcc
acaaaagcatggaccatcacagacacaactgaacactccactcaattacattacacaaaa
ttggcagaaaaatcatctggatttgagacacagtcagctccaggacctgtctctgtagta
atccctacctcccctaccattggaagcagcacattggaactaacttctgatgtcccaggg
gaacccctggtccttgctcccagtgagcagaccacaatcactctccccatggcaacatgg
ctgagtaccagtttgacagaggaaatggcttcaacagaccttgatatttcaagtccaagt
tcacccatgagtacatttgctatttttccacctatgtccacaccttctcatgaactttca
aagtcagaggcagataccagtgccattagaaatacagattcaacaacgttggatcagcac
ctaggaatcaggagtttgggcagaactggggacttaacaactgttcctatcaccccactg
acaaccacgtggaccagtgtgattgaacactcaacacaagcacaggacaccctttctgca
acgatgagtcctactcacgtgacacagtcactcaaagatcaaacatctataccagcctca
gcatccccttcccatcttactgaagtctaccctgagctcgggacacaagggagaagctcc
tctgaggcaaccactttttggaaaccatctacagacacactgtccagagagattgagact
ggcccaacaaacattcaatccactccacccatggacaacacaacaacagggagcagtagt
agtggagtcaccctgggcatagcccaccttcccataggaacatcctccccagctgagaca
tccacaaacatggcactggaaagaagaagttctacagccactgtctctatggctgggaca
atgggactccttgttactagtgctccaggaagaagcatcagccagtcattaggaagagtt
tcctctgtcctttctgagtcaactactgaaggagtcacagattctagtaagggaagcagc
ccaaggctgaacacacagggaaatacagctctctcctcctctcttgaacccagctatgct
gaaggaagccagatgagcacaagcatccctctaacctcatctcctacaactcctgatgtg
gaattcatagggggcagcacattttggaccaaggaggtcaccacagttatgacctcagac
atctccaagtcttcagcaaggacagagtccagctcagctacccttatgtccacagctttg
ggaagcactgaaaatacaggaaaagaaaaactcagaactgcctctatggatcttccatct
ccaactccatcaatggaggtgacaccatggatttctctcactctcagtaatgcccccaat
accacagattcacttgacctcagccatggggtgcacaccagctctgcagggactttggcc
actgacaggtcattgaatactggtgtcactagagcctccagattggaaaacggctctgat
acctcttctaagtccctgtctatgggaaacagcactcacacttccatgacttacacagag
aagagtgaagtgtcttcttcaatccatccccgacctgagacctcagctcctggagcagag
accactttgacttccactcctggaaacagggccataagcttaacattgcctttttcatcc
attccagtggaagaagtcatttctacaggcataacctcaggaccagacatcaactcagca
cccatgacacattctcccatcaccccaccaacaattgtatggaccagtacaggcacaatt
gaacagtccactcaaccactacatgcagtttcttcagaaaaagtttctgtgcagacacag
tcaactccatatgtcaactctgtggcagtgtctgcttcccctacccatgagaattcagtc
tcttctggaagcagcacatcctctccatattcctcagcctcacttgaatccttggattcc
acaatcagtaggaggaatgcaatcacttcctggctatgggacctcactacatctctcccc
actacaacttggccaagtactagtttatctgaggcactgtcctcaggccattctggggtt
tcaaacccaagttcaactacgactgaatttccactcttttcagctgcatccacatctgct
gctaagcaaagaaatccagaaacagagacccatggtccccagaatacagccgcgagtact
ttgaacactgatgcatcctcggtcacaggtctttctgagactcctgtgggggcaagtatc
agctctgaagtccctcttccaatggccataacttctagatcagatgtttctggccttaca
tctgagagtactgctaacccgagtttaggcacagcctcttcagcagggaccaaattaact
aggacaatatccctgcccacttcagagtctttggtttcctttagaatgaacaaggatcca
tggacagtgtcaatccctttggggtcccatccaactactaatacagaaacaagcatccca
gtaaacagcgcaggtccacctggcttgtccacagtagcatcagatgtaattgacacacct
tcagatggggctgagagtattcccactgtctccttttccccctcccctgatactgaagtg
acaactatctcacatttcccagaaaagacaactcattcatttagaaccatttcatctctc
actcatgagttgacttcaagagtgacacctattcctggggattggatgagttcagctatg
tctacaaagcccacaggagccagtccctccattacactgggagagagaaggacaatcacc
tctgctgctccaaccacttcccccatagttctcactgctagtttcacagagaccagcaca
gtttcactggataatgaaactacagtaaaaacctcagatatccttgacgcacggaaaaca
aatgagctcccctcagatagcagttcttcttctgatctgatcaacacctccatagcttct
tcaactatggatgtcactaaaacagcctccatcagtcccactagcatctcaggaatgaca
gcaagttcctccccatctctcttctcttcagatagaccccaggttcccacatctacaaca
gagacaaatacagccacctctccatctgtttccagtaacacctattctcttgatgggggc
tccaatgtgggtggcactccatccactttaccaccctttacaatcacccaccctgtcgag
acaagctcggccctattagcctggtctagaccagtaagaactttcagcaccatggtcagc
actgacactgcctccggagaaaatcctacctctagcaattctgtggtgacttctgttcca
gcaccaggtacatggaccagtgtaggcagtactactgacttacctgccatgggctttctc
aagacaagtcctgcaggagaggcacactcacttctagcatcaactattgaaccagccact
gccttcactccccatctctcagcagcagtggtcactggatccagtgctacatcagaagcc
agtcttctcactacgagtgaaagcaaagccattcattcttcaccacagaccccaactaca
cccacctctggagcaaactgggaaacttcagctactcctgagagccttttggtagtcact
gagacttcagacacaacacttacctcaaagattttggtcacagataccatcttgttttca
actgtgtccacgccaccttctaaatttccaagtacggggactctgtctggagcttccttc
cctactttactcccggacactccagccatccctctcactgccactgagccaacaagttca
ttagctacatcctttgattccaccccactggtgactatagcttcggatagtcttggcaca
gtcccagagactaccctgaccatgtcagagacctcaaatggtgatgcactggttcttaag
acagtaagtaacccagataggagcatccctggaatcactatccaaggagtaacagaaagt
ccactccatccttcttccacttccccctctaagattgttgctccacggaatacaacctat
gaaggttcgatcacagtggcactttctactttgcctgcgggaactactggttcccttgta
ttcagtcagagttctgaaaactcagagacaacggctttggtagactcatcagctgggctt
gagagggcatctgtgatgccactaaccacaggaagccagggtatggctagctctggagga
atcagaagtgggtccactcactcaactggaaccaaaacattttcttctctccctctgacc
atgaacccaggtgaggttacagccatgtctgaaatcaccacgaacagactgacagctact
caatcaacagcacccaaagggatacctgtgaagcccaccagtgctgagtcaggcctccta
acacctgtctctgcctcctcaagcccatcaaaggcctttgcctcactgactacagctccc
ccaacttgggggatcccacagtctaccttgacatttgagttttctgaggtcccaagtttg
gatactaagtccgcttctttaccaactcctggacagtccctgaacaccattccagactca
gatgcaagcacagcatcttcctcactgtccaagtctccagaaaaaaacccaagggcaagg
atgatgacttccacaaaggccataagtgcaagctcatttcaatcaacaggttttactgaa
acccctgagggatctgcctccccttctatggcagggcatgaacccagagtccccacttca
ggaacaggggaccctagatatgcctcagagagcatgtcttatccagacccaagcaaggca
tcatcagctatgacatcgacctctcttgcatcaaaactcacaactctcttcagcacaggt
caagcagcaaggtctggttctagttcctctcccataagcctatccactgagaaagaaaca
agcttcctttcccccactgcatccacctccagaaagacttcactatttcttgggccttcc
atggcaaggcagcccaacatattggtgcatcttcagacttcagctctgacactttctcca
acatccactctaaatatgtcccaggaggagcctcctgagttaacctcaagccagaccatt
gcagaagaagagggaacaacagctgaaacacagacgttaaccttcacaccatctgagacc
ccaacatccttgttacctgtctcttctcccacagaacccacagccagaagaaagagttct
ccagaaacatgggcaagctctatttcagttcctgccaagacctccttggttgaaacaact
gatggaacgctagtgaccaccataaagatgtcaagccaggcagcacaaggaaattccacg
tggcctgccccagcagaggagacggggagcagtccagcaggcacatccccaggaagccca
gaaatgtctaccactctcaaaatcatgagctccaaggaacccagcatcagcccagagatc
aggtccactgtgagaaattctccttggaagactccagaaacaactgttcccatggagacc
acagtggaaccagtcacccttcagtccacagccctaggaagtggcagcaccagcatctct
cacctgcccacaggaaccacatcaccaaccaagtcaccaacagaaaatatgttggctaca
gaaagggtctccctctccccatccccacctgaggcttggaccaacctttattctggaact
ccaggagggaccaggcagtcactggccacaatgtcctctgtctccctagagtcaccaact
gctagaagcatcacagggactggtcagcaaagcagtccagaactggtttcaaagacaact
ggaatggaattctctatgtggcatggctctactggagggaccacaggggacacacatgtc
tctctgagcacatcttccaatatccttgaagaccctgtaaccagcccaaactctgtgagc
tcattgacagataaatccaaacataaaaccgagacatgggtaagcaccacagccattccc
tccactgtcctgaataataagataatggcagctgaacaacagacaagtcgatctgtggat
gaggcttattcatcaactagttcttggtcagatcagacatctgggagtgacatcaccctt
ggtgcatctcctgatgtcacaaacacattatacatcacctccacagcacaaaccacctca
ctagtgtctctgccctctggagaccaaggcattacaagcctcaccaatccctcaggagga
aaaacaagctctgcgtcatctgtcacatctccttcaatagggcttgagactctgagggcc
aatgtaagtgcagtgaaaagtgacattgcccctactgctgggcatctatctcagacttca
tctcctgcggaagtgagcatcctggacgtaaccacagctcctactccaggtatctccacc
accatcaccaccatgggaaccaactcaatctcaactaccacacccaacccagaagtgggt
atgagtaccatggacagcaccccggccacagagaggcgcacaacttctacagaacaccct
tccacctggtcttccacagctgcatcagattcctggactgtcacagacatgacttcaaac
ttgaaagttgcaagatctcctggaacaatttccacaatgcatacaacttcattcttagcc
tcaagcactgaattagactccatgtctactccccatggccgtataactgtcattggaacc
agcctggtcactccatcctctgatgcttcagctgtaaagacagagaccagtacaagtgaa
agaacattgagtccttcagacacaactgcatctactcccatctcaactttttctcgtgtc
cagaggatgagcatctcagttcctgacattttaagtacaagttggactcccagtagtaca
gaagcagaagatgtgcctgtttcaatggtttctacagatcatgctagtacaaagactgac
ccaaatacgcccctgtccacttttctgtttgattctctgtccactcttgactgggacact
gggagatctctgtcatcagccacagccactacctcagctcctcagggggccacaactccc
caggaactcactttggaaaccatgatcagcccagctacctcacagttgcccttctctata
gggcacattacaagtgcagtcacaccagctgcaatggcaaggagctctggagttactttt
tcaagaccagatcccacaagcaaaaaggcagagcagacttccactcagcttcccaccacc
acttctgcacatccagggcaggtgcccagatcagcagcaacaactctggatgtgatccca
cacacagcaaaaactccagatgcaacttttcagagacaagggcagacagctcttacaaca
gaggcaagagctacatctgactcctggaatgagaaagaaaaatcaaccccaagtgcacct
tggatcactgagatgatgaattctgtctcagaagataccatcaaggaggttaccagctcc
tccagtgtattaaggaccctgaatacgctggacataaacttggaatctgggacgacttca
tccccaagttggaaaagcagcccatatgagagaattgccccttctgagtccaccacagac
aaagaggcaattcacccttctacaaacacagtagagaccacaggctgggtcacaagttcc
gaacatgcttctcattccactatcccagcccactcagcgtcatccaaactcacatctcca
gtggttacaacctccaccagggaacaagcaatagtttctatgtcaacaaccacatggcca
gagtctacaagggctagaacagagcctaattccttcttgactattgaactgagggacgtc
agcccttacatggacaccagctcaaccacacaaacaagtattatctcttccccaggttcc
actgcgatcaccaaggggcctagaacagaaattacctcctctaagagaatatccagctca
ttccttgcccagtctatgaggtcgtcagacagcccctcagaagccatcaccaggctgtct
aactttcctgccatgacagaatctggaggaatgatccttgctatgcaaacaagtccacct
ggcgctacatcactaagtgcacctactttggatacatcagccacagcctcctggacaggg
actccactggctacgactcagagatttacatactcagagaagaccactctctttagcaaa
ggtcctgaggatacatcacagccaagccctccctctgtggaagaaaccagctcttcctct
tccctggtacctatccatgctacaacctcgccttccaatattttgttgacatcacaaggg
cacagtccctcctctactccacctgtgacctcagttttcttgtctgagacctctggcctg
gggaagaccacagacatgtcgaggataagcttggaacctggcacaagtttacctcccaat
ttgagcagtacagcaggtgaggcgttatccacttatgaagcctccagagatacaaaggca
attcatcattctgcagacacagcagtgacgaatatggaggcaaccagttctgaatattct
cctatcccaggccatacaaagccatccaaagccacatctccattggttacctcccacatc
atgggggacatcacttcttccacatcagtatttggctcctccgagaccacagagattgag
acagtgtcctctgtgaaccagggacttcaggagagaagcacatcccaggtggccagctct
gctacagagacaagcactgtcattacccatgtgtctagtggtgatgctactactcatgtc
accaagacacaagccactttctctagcggaacatccatctcaagccctcatcagtttata
acttctaccaacacatttacagatgtgagcaccaacccctccacctctctgataatgaca
gaatcttcaggagtgaccatcaccacccaaacaggtcctactggagctgcaacacagggt
ccatatctcttggacacatcaaccatgccttacttgacagagactccattagctgtgact
ccagattttatgcaatcagagaagaccactctcataagcaaaggtcccaaggatgtgtcc
tggacaagccctccctctgtggcagaaaccagctatccctcttccctgacacctttcttg
gtcacaaccatacctcctgccacttccacgttacaagggcaacatacatcctctcctgtt
tctgcgacttcagttcttacctctggactggtgaagaccacagatatgttgaacacaagc
atggaacctgtgaccaattcacctcaaaatttgaacaatccatcaaatgagatactggcc
actttggcagccaccacagatatagagactattcatccttccataaacaaagcagtgacc
aatatggggactgccagttcagcacatgtactgcattccactctcccagtcagctcagaa
ccatctacagccacatctccaatggttcctgcctccagcatgggggacgctcttgcttct
atatcaatacctggttctgagaccacagacattgagggagagccaacatcctccctgact
gctggacgaaaagagaacagcaccctccaggagatgaactcaactacagagtcaaacatc
atcctctccaatgtgtctgtgggggctattactgaagccacaaaaatggaagtcccctct
tttgatgcaacattcataccaactcctgctcagtcaacaaagttcccagatattttctca
gtagccagcagtagactttcaaactctcctcccatgacaatatctacccacatgaccacc
acccagacagggtcttctggagctacatcaaagattccacttgccttagacacatcaacc
ttggaaacctcagcagggactccatcagtggtgactgaggggtttgcccactcaaaaata
accactgcaatgaacaatgatgtcaaggacgtgtcacagacaaaccctccctttcaggat
gaagccagctctccctcttctcaagcacctgtccttgtcacaaccttaccttcttctgtt
gctttcacaccgcaatggcacagtacctcctctcctgtttctatgtcctcagttcttact
tcttcactggtaaagaccgcaggcaaggtggatacaagcttagaaacagtgaccagttca
cctcaaagtatgagcaacactttggatgacatatcggtcacttcagcagccaccacagat
atagagacaacgcatccttccataaacacagtagttaccaatgtggggaccaccggttca
gcatttgaatcacattctactgtctcagcttacccagagccatctaaagtcacatctcca
aatgttaccacctccaccatggaagacaccacaatttccagatcaatacctaaatcctct
aagactacaagaactgagactgagacaacttcctccctgactcctaaactgagggagacc
agcatctcccaggagatcacctcgtccacagagacaagcactgttccttacaaagagctc
actggtgccactaccgaggtatccaggacagatgtcacttcctctagcagtacatccttc
cctggccctgatcagtccacagtgtcactagacatctccacagaaaccaacaccaggctg
tctacctccccaataatgacagaatctgcagaaataaccatcaccacccaaacaggtcct
catggggctacatcacaggatacttttaccatggacccatcaaatacaaccccccaggca
gggatccactcagctatgactcatggattttcacaattggatgtgaccactcttatgagc
agaattccacaggatgtatcatggacaagtcctccctctgtggataaaaccagctccccc
tcttcctttctgtcctcacctgcaatgaccacaccttccctgatttcttctaccttacca
gaggataagctctcctctcctatgacttcacttctcacctctggcctagtgaagattaca
gacatattacgtacacgcttggaacctgtgaccagctcacttccaaatttcagcagcacc
tcagataagatactggccacttctaaagacagtaaagacacaaaggaaatttttccttct
ataaacacagaagagaccaatgtgaaagccaacaactctggacatgaatcccattcccct
gcactggctgactcagagacacccaaagccacaactcaaatggttatcaccaccactgtg
ggagatccagctccttccacatcaatgccagtgcatggttcctctgagactacaaacatt
aagagagagccaacatatttcttgactcctagactgagagagaccagtacctctcaggag
tccagctttcccacggacacaagttttctactttccaaagtccccactggtactattact
gaggtctccagtacaggggtcaactcttctagcaaaatttccaccccagaccatgataag
tccacagtgccacctgacaccttcacaggagagatccccagggtcttcacctcctctatt
aagacaaaatctgcagaaatgacgatcaccacccaagcaagtcctcctgagtctgcatcg
cacagtacccttcccttggacacatcaaccacactttcccagggagggactcattcaact
gtgactcagggattcccatactcagaggtgaccactctcatgggcatgggtcctgggaat
gtgtcatggatgacaactccccctgtggaagaaaccagctctgtgtcttccctgatgtct
tcacctgccatgacatccccttctcctgtttcctccacatcaccacagagcatcccctcc
tctcctcttcctgtgactgcacttcctacttctgttctggtgacaaccacagatgtgttg
ggcacaacaagcccagagtctgtaaccagttcacctccaaatttgagcagcatcactcat
gagagaccggccacttacaaagacactgcacacacagaagccgccatgcatcattccaca
aacaccgcagtgaccaatgtagggacttccgggtctggacataaatcacaatcctctgtc
ctagctgactcagagacatcgaaagccacacctctgatgagtaccacctccaccctgggg
gacacaagtgtttccacatcaactcctaatatctctcagactaaccaaattcaaacagag
ccaacagcatccctgagccctagactgagggagagcagcacgtctgagaagaccagctca
acaacagagacaaatactgccttttcttatgtgcccacaggtgctattactcaggcctcc
agaacagaaatctcctctagcagaacatccatctcagaccttgatcggcccacaatagca
cccgacatctccacaggaatgatcaccaggctcttcacctcccccatcatgacaaaatct
gcagaaatgaccgtcaccactcaaacaactactcctggggctacatcacagggtatcctt
ccctgggacacatcaaccacacttttccagggagggactcattcaaccgtgtctcaggga
ttcccacactcagagataaccactcttcggagcagaacccctggagatgtgtcatggatg
acaactccccctgtggaagaaaccagctctgggttttccctgatgtcaccttccatgaca
tccccttctcctgtttcctccacatcaccagagagcatcccctcctctcctctccctgtg
actgcacttcttacttctgttctggtgacaaccacaaatgtattgggcacaacaagccca
gagcccgtaacgagttcacctccaaatttaagcagccccacacaggagagactgaccact
tacaaagacactgcgcacacagaagccatgcatgcttccatgcatacaaacactgcagtg
gccaacgtggggacctccatttctggacatgaatcacaatcttctgtcccagctgattca
cacacatccaaagccacatctccaatgggtatcaccttcgccatgggggatacaagtgtt
tctacatcaactcctgccttctttgagactagaattcagactgaatcaacatcctctttg
attcctggattaagggacaccaggacgtctgaggagatcaacactgtgacagagaccagc
actgtcctttcagaagtgcccactactactactactgaggtctccaggacagaagttatc
acttccagcagaacaaccatctcagggcctgatcattccaaaatgtcaccctacatctcc
acagaaaccatcaccaggctctccacttttccttttgtaacaggatccacagaaatggcc
atcaccaaccaaacaggtcctatagggactatctcacaggctacccttaccctggacaca
tcaagcacagcttcctgggaagggactcactcacctgtgactcagagatttccacactca
gaggagaccactactatgagcagaagtactaagggcgtgtcatggcaaagccctccctct
gtggaagaaaccagttctccttcttccccagtgcctttacctgcaataacctcacattca
tctctttattccgcagtatcaggaagtagccccacttctgctctccctgtgacttccctt
ctcacctctggcaggaggaagaccatagacatgttggacacacactcagaacttgtgacc
agctccttaccaagtgcaagtagcttctcaggtgagatactcacttctgaagcctccaca
aatacagagacaattcacttttcagagaacacagcagaaaccaatatggggaccaccaat
tctatgcataaactacattcctctgtctcaatccactcccagccatccggacacacacct
ccaaaggttactggatctatgatggaggacgctattgtttccacatcaacacctggttct
cctgagactaaaaatgttgacagagactcaacatcccctctgactcctgaactgaaagag
gacagcaccgccctggtgatgaactcaactacagagtcaaacactgttttctccagtgtg
tccctggatgctgctactgaggtctccagggcagaagtcacctactatgatcctacattc
atgccagcttctgctcagtcaacaaagtccccagacatttcacctgaagccagcagcagt
cattctaactctcctcccttgacaatatctacacacaagaccatcgccacacaaacaggt
ccttctggggtgacatctcttggccaactgaccctggacacatcaaccatagccacctca
gcaggaactccatcagccagaactcaggattttgtagattcagaaacaaccagtgtcatg
aacaatgatctcaatgatgtgttgaagacaagccctttctctgcagaagaagccaactct
ctctcttctcaggcacctctccttgtgacaacctcaccttctcctgtaacttccacattg
caagagcacagtacctcctctcttgtttctgtgacctcagtacccacccctacactggcg
aagatcacagacatggacacaaacttagaacctgtgactcgttcacctcaaaatttaagg
aacaccttggccacttcagaagccaccacagatacacacacaatgcatccttctataaac
acagcagtggccaatgtggggaccaccagttcaccaaatgaattctattttactgtctca
cctgactcagacccatataaagccacatccgcagtagttatcacttccacctcgggggac
tcaatagtttccacatcaatgcctagatcctctgcgatgaaaaagattgagtctgagaca
actttctccctgatatttagactgagggagactagcacctcccagaaaattggctcatcc
tcagacacaagcacggtctttgacaaagcattcactgctgctactactgaggtctccaga
acagaactcacctcctctagcagaacatccatccaaggcactgaaaagcccacaatgtca
ccggacacctccacaagatctgtcaccatgctttctacttttgctggcctgacaaaatcc
gaagaaaggaccattgccacccaaacaggtcctcatagggcgacatcacagggtaccctt
acctgggacacatcaatcacaacctcacaggcagggacccactcagctatgactcatgga
ttttcacaattagatttgtccactcttacgagtagagttcctgagtacatatcagggaca
agcccaccctctgtggaaaaaaccagctcttcctcttcccttctgtctttaccagcaata
acctcaccgtcccctgtacctactacattaccagaaagtaggccgtcttctcctgttcat
ctgacttcactccccacctctggcctagtgaagaccacagatatgctggcatctgtggcc
agtttacctccaaacttgggcagcacctcacataagataccgactacttcagaagacatt
aaagatacagagaaaatgtatccttccacaaacatagcagtaaccaatgtggggaccacc
acttctgaaaaggaatcttattcgtctgtcccagcctactcagaaccacccaaagtcacc
tctccaatggttacctctttcaacataagggacaccattgtttccacatccatgcctggc
tcctctgagattacaaggattgagatggagtcaacattctccctggctcatgggctgaag
ggaaccagcacctcccaggaccccatcgtatccacagagaaaagtgctgtccttcacaag
ttgaccactggtgctactgagacctctaggacagaagttgcctcttctagaagaacatcc
attccaggccctgatcattccacagagtcaccagacatctccactgaagtgatccccagc
ctgcctatctcccttggcattacagaatcttcaaatatgaccatcatcactcgaacaggt
cctcctcttggctctacatcacagggcacatttaccttggacacaccaactacatcctcc
agggcaggaacacactcgatggcgactcaggaatttccacactcagaaatgaccactgtc
atgaacaaggaccctgagattctatcatggacaatccctccttctatagagaaaaccagc
ttctcctcttccctgatgccttcaccagccatgacttcacctcctgtttcctcaacatta
ccaaagaccattcacaccactccttctcctatgacctcactgctcacccctagcctagtg
atgaccacagacacattgggcacaagcccagaacctacaaccagttcacctccaaatttg
agcagtacctcacatgagatactgacaacagatgaagacaccacagctatagaagccatg
catccttccacaagcacagcagcgactaatgtggaaaccaccagttctggacatgggtca
caatcctctgtcctagctgactcagaaaaaaccaaggccacagctccaatggataccacc
tccaccatggggcatacaactgtttccacatcaatgtctgtttcctctgagactacaaaa
attaagagagagtcaacatattccttgactcctggactgagagagaccagcatttcccaa
aatgccagcttttccactgacacaagtattgttctttcagaagtccccactggtactact
gctgaggtctccaggacagaagtcacctcctctggtagaacatccatccctggcccttct
cagtccacagttttgccagaaatatccacaagaacaatgacaaggctctttgcctcgccc
accatgacagaatcagcagaaatgaccatccccactcaaacaggtccttctgggtctacc
tcacaggatacccttaccttggacacatccaccacaaagtcccaggcaaagactcattca
actttgactcagagatttccacactcagagatgaccactctcatgagcagaggtcctgga
gatatgtcatggcaaagctctccctctctggaaaatcccagctctctcccttccctgctg
tctttacctgccacaacctcacctcctcccatttcctccacattaccagtgactatctcc
tcctctcctcttcctgtgacttcacttctcacctctagcccggtaacgaccacagacatg
ttacacacaagcccagaacttgtaaccagttcacctccaaagctgagccacacttcagat
gagagactgaccactggcaaggacaccacaaatacagaagctgtgcatccttccacaaac
acagcagcgtccaatgtggagattcccagctctggacatgaatccccttcctctgcctta
gctgactcagagacatccaaagccacatcaccaatgtttattacctccacccaggaggat
acaactgttgccatatcaacccctcacttcttggagactagcagaattcagaaagagtca
atttcctccctgagccctaaattgagggagacaggcagttctgtggagacaagctcagcc
atagagacaagtgctgtcctttctgaagtgtccattggtgctactactgagatctccagg
acagaagtcacctcctctagcagaacatccatctctggttctgctgagtccacaatgttg
ccagaaatatccaccacaagaaaaatcattaagttccctacttcccccatcctggcagaa
tcatcagaaatgaccatcaagacccaaacaagtcctcctgggtctacatcagagagtacc
tttacattagacacatcaaccactccctccttggtaataacccattcgactatgactcag
agattgccacactcagagataaccactcttgtgagtagaggtgctggggatgtgccacgg
cccagctctctccctgtggaagaaacaagccctccatcttcccagctgtctttatctgcc
atgatctcaccttctcctgtttcttccacattaccagcaagtagccactcctcttctgct
tctgtgacttcacttctcacaccaggccaagtgaagactactgaggtgttggacgcaagt
gcagaacctgaaaccagttcacctccaagtttgagcagcacctcagttgaaatactggcc
acctctgaagtcaccacagatacggagaaaattcatcctttctcaaacacggcagtaacc
aaagttggaacttccagttctggacatgaatccccttcctctgtcctacctgactcagag
acaaccaaagccacatcggcaatgggtaccatctccattatgggggatacaagtgtttct
acattaactcctgccttatctaacactaggaaaattcagtcagagccagcttcctcactg
accaccagattgagggagaccagcacctctgaagagaccagcttagccacagaagcaaac
actgttctttctaaagtgtccactggtgctactactgaggtctccaggacagaagccatc
tcctttagcagaacatccatgtcaggccctgagcagtccacaatgtcacaagacatctcc
ataggaaccatccccaggatttctgcctcctctgtcctgacagaatctgcaaaaatgacc
atcacaacccaaacaggtccttcggagtctacactagaaagtacccttaatttgaacaca
gcaaccacaccctcttgggtggaaacccactctatagtaattcagggatttccacaccca
gagatgaccacttccatgggcagaggtcctggaggtgtgtcatggcctagccctcccttt
gtgaaagaaaccagccctccatcctccccgctgtctttacctgccgtgacctcacctcat
cctgtttccaccacattcctagcacatatccccccctctccccttcctgtgacttcactt
ctcacctctggcccggcgacaaccacagatatcttgggtacaagcacagaacctggaacc
agttcatcttcaagtttgagcaccacctcccatgagagactgaccacttacaaagacact
gcacatacagaagccgtgcatccttccacaaacacaggagggaccaatgtggcaaccacc
agctctggatataaatcacagtcctctgtcctagctgactcatctccaatgtgtaccacc
tccaccatgggggatacaagtgttctcacatcaactcctgccttccttgagactaggagg
attcagacagagctagcttcctccctgacccctggattgagggagtccagcggctctgaa
gggaccagctcaggcaccaagatgagcactgtcctctctaaagtgcccactggtgctact
actgagatctccaaggaagacgtcacctccatcccaggtcccgctcaatccacaatatca
ccagacatctccacaagaaccgtcagctggttctctacatcccctgtcatgacagaatca
gcagaaataaccatgaacacccatacaagtcctttaggggccacaacacaaggcaccagt
actttggacacgtcaagcacaacctctttgacaatgacacactcaactatatctcaagga
ttttcacactcacagatgagcactcttatgaggaggggtcctgaggatgtatcatggatg
agccctccccttctggaaaaaactagaccttccttttctctgatgtcttcaccagccaca
acttcaccttctcctgtttcctccacattaccagagagcatctcttcctctcctcttcct
gtgacttcactcctcacgtctggcttggcaaaaactacagatatgttgcacaaaagctca
gaacctgtaaccaactcacctgcaaatttgagcagcacctcagttgaaatactggccacc
tctgaagtcaccacagatacagagaaaactcatccttcttcaaacagaacagtgaccgat
gtggggacctccagttctggacatgaatccacttcctttgtcctagctgactcacagaca
tccaaagtcacatctccaatggttattacctccaccatggaggatacgagtgtctccaca
tcaactcctggcttttttgagactagcagaattcagacagaaccaacatcctccctgacc
cttggactgagaaagaccagcagctctgaggggaccagcttagccacagagatgagcact
gtcctttctggagtgcccactggtgccactgctgaagtctccaggacagaagtcacctcc
tctagcagaacatccatctcaggctttgctcagctcacagtgtcaccagagacttccaca
gaaaccatcaccagactccctacctccagcataatgacagaatcagcagaaatgatgatc
aagacacaaacagatcctcctgggtctacaccagagagtactcatactgtggacatatca
acaacacccaactgggtagaaacccactcgactgtgactcagagattttcacactcagag
atgaccactcttgtgagcagaagccctggtgatatgttatggcctagtcaatcctctgtg
gaagaaaccagctctgcctcttccctgctgtctctgcctgccacgacctcaccttctcct
gtttcctctacattagtagaggatttcccttccgcttctcttcctgtgacttctcttctc
aaccctggcctggtgataaccacagacaggatgggcataagcagagaacctggaaccagt
tccacttcaaatttgagcagcacctcccatgagagactgaccactttggaagacactgta
gatacagaagacatgcagccttccacacacacagcagtgaccaacgtgaggacctccatt
tctggacatgaatcacaatcttctgtcctatctgactcagagacacccaaagccacatct
ccaatgggtaccacctacaccatgggggaaacgagtgtttccatatccacttctgacttc
tttgagaccagcagaattcagatagaaccaacatcctccctgacttctggattgagggag
accagcagctctgagaggatcagctcagccacagagggaagcactgtcctttctgaagtg
cccagtggtgctaccactgaggtctccaggacagaagtgatatcctctaggggaacatcc
atgtcagggcctgatcagttcaccatatcaccagacatctctactgaagcgatcaccagg
ctttctacttcccccattatgacagaatcagcagaaagtgccatcactattgagacaggt
tctcctggggctacatcagagggtaccctcaccttggacacctcaacaacaaccttttgg
tcagggacccactcaactgcatctccaggattttcacactcagagatgaccactcttatg
agtagaactcctggagatgtgccatggccgagccttccctctgtggaagaagccagctct
gtctcttcctcactgtcttcacctgccatgacctcaacttcttttttctccacattacca
gagagcatctcctcctctcctcatcctgtgactgcacttctcacccttggcccagtgaag
accacagacatgttgcgcacaagctcagaacctgaaaccagttcacctccaaatttgagc
agcacctcagctgaaatattagccacgtctgaagtcaccaaagatagagagaaaattcat
ccctcctcaaacacacctgtagtcaatgtagggactgtgatttataaacatctatcccct
tcctctgttttggctgacttagtgacaacaaaacccacatctccaatggctaccacctcc
actctggggaatacaagtgtttccacatcaactcctgccttcccagaaactatgatgaca
cagccaacttcctccctgacttctggattaagggagatcagtacctctcaagagaccagc
tcagcaacagagagaagtgcttctctttctggaatgcccactggtgctactactaaggtc
tccagaacagaagccctctccttaggcagaacatccaccccaggtcctgctcaatccaca
atatcaccagaaatctccacggaaaccatcactagaatttctactcccctcaccacgaca
ggatcagcagaaatgaccatcacccccaaaacaggtcattctggggcatcctcacaaggt
acctttaccttggacacatcaagcagagcctcctggccaggaactcactcagctgcaact
cacagatctccacactcagggatgaccactcctatgagcagaggtcctgaggatgtgtca
tggccaagccgcccatcagtggaaaaaactagccctccatcttccctggtgtctttatct
gcagtaacctcaccttcgccactttattccacaccatctgagagtagccactcatctcct
ctccgggtgacttctcttttcacccctgtcatgatgaagaccacagacatgttggacaca
agcttggaacctgtgaccacttcacctcccagtatgaatatcacctcagatgagagtctg
gccacttctaaagccaccatggagacagaggcaattcagctttcagaaaacacagctgtg
actcagatgggcaccatcagcgctagacaagaattctattcctcttatccaggcctccca
gagccatccaaagtgacatctccagtggtcacctcttccaccataaaagacattgtttct
acaaccatacctgcttcctctgagataacaagaattgagatggagtcaacatccaccctg
acccccacaccaagggagaccagcacctcccaggagatccactcagccacaaagccaagc
actgttccttacaaggcactcactagtgccacgattgaggactccatgacacaagtcatg
tcctctagcagaggacctagccctgatcagtccacaatgtcacaagacatatccactgaa
gtgatcaccaggctctctacctcccccatcaagacagaatctacagaaatgaccattacc
acccaaacaggttctcctggggctacatcaaggggtacccttaccttggacacttcaaca
acttttatgtcagggacccactcaactgcatctcaaggattttcacactcacagatgacc
gctcttatgagtagaactcctggagatgtgccatggctaagccatccctctgtggaagaa
gccagctctgcctctttctcactgtcttcacctgtcatgacctcatcttctcccgtttct
tccacattaccagacagcatccactcttcttcgcttcctgtgacatcacttctcacctca
gggctggtgaagaccacagagctgttgggcacaagctcagaacctgaaaccagttcaccc
ccaaatttgagcagcacctcagctgaaatactggccatcactgaagtcactacagataca
gagaaactggagatgaccaatgtggtaacctcaggttatacacatgaatctccttcctct
gtcctagctgactcagtgacaacaaaggccacatcttcaatgggtatcacctaccccaca
ggagatacaaatgttctcacatcaacccctgccttctctgacaccagtaggattcaaaca
aagtcaaagctctcactgactcctgggttgatggagaccagcatctctgaagagaccagc
tctgccacagaaaaaagcactgtcctttctagtgtgcccactggtgctactactgaggtc
tccaggacagaagccatctcttctagcagaacatccatcccaggccctgctcaatccaca
atgtcatcagacacctccatggaaaccatcactagaatttctacccccctcacaaggaaa
gaatcaacagacatggccatcacccccaaaacaggtccttctggggctacctcgcagggt
acctttaccttggactcatcaagcacagcctcctggccaggaactcactcagctacaact
cagagatttccacagtcagtggtgacaactcctatgagcagaggtcctgaggatgtgtca
tggccaagcccgctgtctgtggaaaaaaacagccctccatcttccctggtatcttcatct
tcagtaacctcaccttcgccactttattccacaccatctgggagtagccactcctctcct
gtccctgtcacttctcttttcacctctatcatgatgaaggccacagacatgttggatgca
agtttggaacctgagaccacttcagctcccaatatgaatatcacctcagatgagagtctg
gccgcttctaaagccaccacggagacagaggcaattcacgtttttgaaaatacagcagcg
tcccatgtggaaaccaccagtgctacagaggaactctattcctcttccccaggcttctca
gagccaacaaaagtgatatctccagtggtcacctcttcctctataagagacaacatggtt
tccacaacaatgcctggctcctctggcattacaaggattgagatagagtcaatgtcatct
ctgacccctggactgagggagaccagaacctcccaggacatcacctcatccacagagaca
agcactgtcctttacaagatgccctctggtgccactcctgaggtctccaggacagaagtt
atgccctctagcagaacatccattcctggccctgctcagtccacaatgtcactagacatc
tccgatgaagttgtcaccaggctgtctacctctcccatcatgacagaatctgcagaaata
accatcaccacccaaacaggttattctctggctacatcccaggttacccttcccttgggc
acctcaatgacctttttgtcagggacccactcaactatgtctcaaggactttcacactca
gagatgaccaatcttatgagcaggggtcctgaaagtctgtcatggacgagccctcgcttt
gtggaaacaactagatcttcctcttctctgacatcattacctctcacgacctcactttct
cctgtgtcctccacattactagacagtagcccctcctctcctcttcctgtgacttcactt
atcctcccaggcctggtgaagactacagaagtgttggatacaagctcagagcctaaaacc
agttcatctccaaatttgagcagcacctcagttgaaataccggccacctctgaaatcatg
acagatacagagaaaattcatccttcctcaaacacagcggtggccaaagtgaggacctcc
agttctgttcatgaatctcattcctctgtcctagctgactcagaaacaaccataaccata
ccttcaatgggtatcacctccgctgtggacgataccactgttttcacatcaaatcctgcc
ttctctgagactaggaggattccgacagagccaacattctcattgactcctggattcagg
gagactagcacctctgaagagaccacctcaatcacagaaacaagtgcagtcctttatgga
gtgcccactagtgctactactgaagtctccatgacagaaatcatgtcctctaatagaata
cacatccctgactctgatcagtccacgatgtctccagacatcatcactgaagtgatcacc
aggctctcttcctcatccatgatgtcagaatcaacacaaatgaccatcaccacccaaaaa
agttctcctggggctacagcacagagtactcttaccttggccacaacaacagcccccttg
gcaaggacccactcaactgttcctcctagatttttacactcagagatgacaactcttatg
agtaggagtcctgaaaatccatcatggaagagctctctctttgtggaaaaaactagctct
tcatcttctctgttgtccttacctgtcacgacctcaccttctgtttcttccacattaccg
cagagtatcccttcctcctctttttctgtgacttcactcctcaccccaggcatggtgaag
actacagacacaagcacagaacctggaaccagtttatctccaaatctgagtggcacctca
gttgaaatactggctgcctctgaagtcaccacagatacagagaaaattcatccttcttca
agcatggcagtgaccaatgtgggaaccaccagttctggacatgaactatattcctctgtt
tcaatccactcggagccatccaaggctacatacccagtgggtactccctcttccatggct
gaaacctctatttccacatcaatgcctgctaattttgagaccacaggatttgaggctgag
ccattttctcatttgacttctggatttaggaagacaaacatgtccctggacaccagctca
gtcacaccaacaaatacaccttcttctcctgggtccactcaccttttacagagttccaag
actgatttcacctcttctgcaaaaacatcatccccagactggcctccagcctcacagtat
actgaaattccagtggacataatcaccccctttaatgcttctccatctattacggagtcc
actgggataacctccttcccagaatccaggtttactatgtctgtaacagaaagtactcat
catctgagtacagatttgctgccttcagctgagactatttccactggcacagtgatgcct
tctctatcagaggccatgacttcatttgccaccactggagttccacgagccatctcaggt
tcaggtagtccattctctaggacagagtcaggccctggggatgctactctgtccaccatt
gcagagagcctgccttcatccactcctgtgccattctcctcttcaaccttcactaccact
gattcttcaaccatcccagccctccatgagataacttcctcttcagctaccccatataga
gtggacaccagtcttgggacagagagcagcactactgaaggacgcttggttatggtcagt
actttggacacttcaagccaaccaggcaggacatcttcatcacccattttggataccaga
atgacagagagcgttgagctgggaacagtgacaagtgcttatcaagttccttcactctca
acacggttgacaagaactgatggcattatggaacacatcacaaaaatacccaatgaagca
gcacacagaggtaccataagaccagtcaaaggccctcagacatccacttcgcctgccagt
cctaaaggactacacacaggagggacaaaaagaatggagaccaccaccacagctctgaag
accaccaccacagctctgaagaccacttccagagccaccttgaccaccagtgtctatact
cccactttgggaacactgactcccctcaatgcatcaatgcaaatggccagcacaatcccc
acagaaatgatgatcacaaccccatatgttttccctgatgttccagaaacgacatcctca
ttggctaccagcctgggagcagaaaccagcacagctcttcccaggacaaccccatctgtt
ttcaatagagaatcagagaccacagcctcactggtctctcgttctggggcagagagaagt
ccggttattcaaactctagatgtttcttctagtgagccagatacaacagcttcatgggtt
atccatcctgcagagaccatcccaactgtttccaagacaacccccaattttttccacagt
gaattagacactgtatcttccacagccaccagtcatggggcagacgtcagctcagccatt
ccaacaaatatctcacctagtgaactagatgcactgaccccactggtcactatttcgggg
acagatactagtacaacattcccaacactgactaagtccccacatgaaacagagacaaga
accacatggctcactcatcctgcagagaccagctcaactattcccagaacaatccccaat
ttttctcatcatgaatcagatgccacaccttcaatagccaccagtcctggggcagaaacc
agttcagctattccaattatgactgtctcacctggtgcagaagatctggtgacctcacag
gtcactagttctgggacagacagaaatatgactattccaactttgactctttctcctggt
gaaccaaagacgatagcctcattagtcacccatcctgaagcacagacaagttcggccatt
ccaacttcaactatctcgcctgctgtatcacggttggtgacctcaatggtcaccagtttg
gcggcaaagacaagtacaactaatcgagctctgacaaactcccctggtgaaccagctaca
acagtttcattggtcacgcatcctgcacagaccagcccaacagttccctggacaacttcc
atttttttccatagtaaatcagacaccacaccttcaatgaccaccagtcatggggcagaa
tccagttcagctgttccaactccaactgtttcaactgaggtaccaggagtagtgacccct
ttggtcaccagttctagggcagtgatcagtacaactattccaattctgactctttctcct
ggtgaaccagagaccacaccttcaatggccaccagtcatggggaagaagccagttctgct
attccaactccaactgtttcacctggggtaccaggagtggtgacctctctggtcactagt
tctagggcagtgactagtacaactattccaattctgactttttctcttggtgaaccagag
accacaccttcaatggccaccagtcatgggacagaagctggctcagctgttccaactgtt
ttacctgaggtaccaggaatggtgacctctctggttgctagttctagggcagtaaccagt
acaactcttccaactctgactctttctcctggtgaaccagagaccacaccttcaatggcc
accagtcatggggcagaagccagctcaactgttccaactgtttcacctgaggtaccagga
gtggtgacctctctggtcactagttctagtggagtaaacagtacaagtattccaactctg
attctttctcctggtgaactagaaaccacaccttcaatggccaccagtcatggggcagaa
gccagctcagctgttccaactccaactgtttcacctggggtatcaggagtggtgacccct
ctggtcactagttccagggcagtgaccagtacaactattccaattctaactctttcttct
agtgagccagagaccacaccttcaatggccaccagtcatggggtagaagccagctcagct
gttctaactgtttcacctgaggtaccaggaatggtgacctctctggtcactagttctaga
gcagtaaccagtacaactattccaactctgactatttcttctgatgaaccagagaccaca
acttcattggtcacccattctgaggcaaagatgatttcagccattccaactttagctgtc
tcccctactgtacaagggctggtgacttcactggtcactagttctgggtcagagaccagt
gcgttttcaaatctaactgttgcctcaagtcaaccagagaccatagactcatgggtcgct
catcctgggacagaagcaagttctgttgttccaactttgactgtctccactggtgagccg
tttacaaatatctcattggtcacccatcctgcagagagtagctcaactcttcccaggaca
acctcaaggttttcccacagtgaattagacactatgccttctacagtcaccagtcctgag
gcagaatccagctcagccatttcaacaactatttcacctggtataccaggtgtgctgaca
tcactggtcactagctctgggagagacatcagtgcaacttttccaacagtgcctgagtcc
ccacatgaatcagaggcaacagcctcatgggttactcatcctgcagtcaccagcacaaca
gttcccaggacaacccctaattattctcatagtgaaccagacaccacaccatcaatagcc
accagtcctggggcagaagccacttcagattttccaacaataactgtctcacctgatgta
ccagatatggtaacctcacaggtcactagttctgggacagacaccagtataactattcca
actctgactctttcttctggtgagccagagaccacaacctcatttatcacctattctgag
acacacacaagttcagccattccaactctccctgtctcccctggtgcatcaaagatgctg
acctcactggtcatcagttctgggacagacagcactacaactttcccaacactgacggag
accccatatgaaccagagacaacagccatacagctcattcatcctgcagagaccaacaca
atggttcccaggacaactcccaagttttcccatagtaagtcagacaccacactcccagta
gccatcaccagtcctgggccagaagccagttcagctgtttcaacgacaactatctcacct
gatatgtcagatctggtgacctcactggtccctagttctgggacagacaccagtacaacc
ttcccaacattgagtgagaccccatatgaaccagagactacagccacgtggctcactcat
cctgcagaaaccagcacaacggtttctgggacaattcccaacttttcccataggggatca
gacactgcaccctcaatggtcaccagtcctggagtagacacgaggtcaggtgttccaact
acaaccatcccacccagtataccaggggtagtgacctcacaggtcactagttctgcaaca
gacactagtacagctattccaactttgactccttctcctggtgaaccagagaccacagcc
tcatcagctacccatcctgggacacagactggcttcactgttccaattcggactgttccc
tctagtgagccagatacaatggcttcctgggtcactcatcctccacagaccagcacacct
gtttccagaacaacctccagtttttcccatagtagtccagatgccacacctgtaatggcc
accagtcctaggacagaagccagttcagctgtactgacaacaatctcacctggtgcacca
gagatggtgacttcacagatcactagttctggggcagcaaccagtacaactgttccaact
ttgactcattctcctggtatgccagagaccacagccttattgagcacccatcccagaaca
gagacaagtaaaacatttcctgcttcaactgtgtttcctcaagtatcagagaccacagcc
tcactcaccattagacctggtgcagagactagcacagctctcccaactcagacaacatcc
tctctcttcaccctacttgtaactggaaccagcagagttgatctaagtccaactgcttca
cctggtgtttctgcaaaaacagccccactttccacccatccagggacagaaaccagcaca
atgattccaacttcaactctttcccttggtttactagagactacaggcttactggccacc
agctcttcagcagagaccagcacgagtactctaactctgactgtttcccctgctgtctct
gggctttccagtgcctctataacaactgataagccccaaactgtgacctcctggaacaca
gaaacctcaccatctgtaacttcagttggacccccagaattttccaggactgtcacaggc
accactatgaccttgataccatcagagatgccaacaccacctaaaaccagtcatggagaa
ggagtgagtccaaccactatcttgagaactacaatggttgaagccactaatttagctacc
acaggttccagtcccactgtggccaagacaacaaccaccttcaatacactggctggaagc
ctctttactcctctgaccacacctgggatgtccaccttggcctctgagagtgtgacctca
agaacaagttataaccatcggtcctggatctccaccaccagcagttataaccgtcggtac
tggacccctgccaccagcactccagtgacttctacattctccccagggatttccacatcc
tccatccccagctccacagcagccacagtcccattcatggtgccattcaccctcaacttc
accatcaccaacctgcagtacgaggaggacatgcggcaccctggttccaggaagttcaac
gccacagagagagaactgcagggtctgctcaaacccttgttcaggaatagcagtctggaa
tacctctattcaggctgcagactagcctcactcaggccagagaaggatagctcagccacg
gcagtggatgccatctgcacacatcgccctgaccctgaagacctcggactggacagagag
cgactgtactgggagctgagcaatctgacaaatggcatccaggagctgggcccctacacc
ctggaccggaacagtctctatgtcaatggtttcacccatcgaagctctatgcccaccacc
agcactcctgggacctccacagtggatgtgggaacctcagggactccatcctccagcccc
agccccacgactgctggccctctcctgatgccgttcaccctcaacttcaccatcaccaac
ctgcagtacgaggaggacatgcgtcgcactggctccaggaagttcaacaccatggagagt
gtcctgcagggtctgctcaagcccttgttcaagaacaccagtgttggccctctgtactct
ggctgcagattgaccttgctcaggcccgagaaagatggggcagccactggagtggatgcc
atctgcacccaccgccttgaccccaaaagccctggactcaacagggagcagctgtactgg
gagctaagcaaactgaccaatgacattgaagagctgggcccctacaccctggacaggaac
agtctctatgtcaatggtttcacccatcagagctctgtgtccaccaccagcactcctggg
acctccacagtggatctcagaacctcagggactccatcctccctctccagccccacaatt
atggctgctggccctctcctggtaccattcaccctcaacttcaccatcaccaacctgcag
tatggggaggacatgggtcaccctggctccaggaagttcaacaccacagagagggtcctg
cagggtctgcttggtcccatattcaagaacaccagtgttggccctctgtactctggctgc
agactgacctctctcaggtctgagaaggatggagcagccactggagtggatgccatctgc
atccatcatcttgaccccaaaagccctggactcaacagagagcggctgtactgggagctg
agccaactgaccaatggcatcaaagagctgggcccctacaccctggacaggaacagtctc
tatgtcaatggtttcacccatcggacctctgtgcccaccagcagcactcctgggacctcc
acagtggaccttggaacctcagggactccattctccctcccaagccccgcaactgctggc
cctctcctggtgctgttcaccctcaacttcaccatcaccaacctgaagtatgaggaggac
atgcatcgccctggctccaggaagttcaacaccactgagagggtcctgcagactctgctt
ggtcctatgttcaagaacaccagtgttggccttctgtactctggctgcagactgaccttg
ctcaggtccgagaaggatggagcagccactggagtggatgccatctgcacccaccgtctt
gaccccaaaagccctggagtggacagggagcagctatactgggagctgagccagctgacc
aatggcatcaaagagctgggcccctacaccctggacaggaacagtctctatgtcaatggt
ttcacccattggatccctgtgcccaccagcagcactcctgggacctccacagtggacctt
gggtcagggactccatcctccctccccagccccacaactgctggccctctcctggtgccg
ttcaccctcaacttcaccatcaccaacctgaagtacgaggaggacatgcattgccctggc
tccaggaagttcaacaccacagagagagtcctgcagagtctgcttggtcccatgttcaag
aacaccagtgttggccctctgtactctggctgcagactgaccttgctcaggtccgagaag
gatggagcagccactggagtggatgccatctgcacccaccgtcttgaccccaaaagccct
ggagtggacagggagcagctatactgggagctgagccagctgaccaatggcatcaaagag
ctgggtccctacaccctggacagaaacagtctctatgtcaatggtttcacccatcagacc
tctgcgcccaacaccagcactcctgggacctccacagtggaccttgggacctcagggact
ccatcctccctccccagccctacatctgctggccctctcctggtgccattcaccctcaac
ttcaccatcaccaacctgcagtacgaggaggacatgcatcacccaggctccaggaagttc
aacaccacggagcgggtcctgcagggtctgcttggtcccatgttcaagaacaccagtgtc
ggccttctgtactctggctgcagactgaccttgctcaggcctgagaagaatggggcagcc
actggaatggatgccatctgcagccaccgtcttgaccccaaaagccctggactcaacaga
gagcagctgtactgggagctgagccagctgacccatggcatcaaagagctgggcccctac
accctggacaggaacagtctctatgtcaatggtttcacccatcggagctctgtggccccc
accagcactcctgggacctccacagtggaccttgggacctcagggactccatcctccctc
cccagccccacaacagctgttcctctcctggtgccgttcaccctcaactttaccatcacc
aatctgcagtatggggaggacatgcgtcaccctggctccaggaagttcaacaccacagag
agggtcctgcagggtctgcttggtcccttgttcaagaactccagtgtcggccctctgtac
tctggctgcagactgatctctctcaggtctgagaaggatggggcagccactggagtggat
gccatctgcacccaccaccttaaccctcaaagccctggactggacagggagcagctgtac
tggcagctgagccagatgaccaatggcatcaaagagctgggcccctacaccctggaccgg
aacagtctctacgtcaatggtttcacccatcggagctctgggctcaccaccagcactcct
tggacttccacagttgaccttggaacctcagggactccatcccccgtccccagccccaca
accaccggccctctcctggtgccattcacactcaacttcaccatcactaacctacagtat
gaggagaacatgggtcaccctggctccaggaagttcaacatcacggagagtgttctgcag
ggtctgctcaagcccttgttcaagagcaccagtgttggccctctgtattctggctgcaga
ctgaccttgctcaggcctgagaaggatggagtagccaccagagtggacgccatctgcacc
caccgccctgaccccaaaatccctgggctagacagacagcagctatactgggagctgagc
cagctgacccacagcatcactgagctgggaccctacaccctggatagggacagtctctat
gtcaatggtttcacccagcggagctctgtgcccaccaccagcactcctgggactttcaca
gtacagccggaaacctctgagactccatcatccctccctggccccacagccactggccct
gtcctgctgccattcaccctcaattttaccatcactaacctgcagtatgaggaggacatg
cgtcgccctggctccaggaagttcaacaccacggagagggtccttcagggtctgcttatg
cccttgttcaagaacaccagtgtcagctctctgtactctggttgcagactgaccttgctc
aggcctgagaaggatggggcagccaccagagtggatgctgtctgcacccatcgtcctgac
cccaaaagccctggactggacagagagcggctgtactggaagctgagccagctgacccac
ggcatcactgagctgggcccctacaccctggacaggcacagtctctatgtcaatggtttc
acccatcagagctctatgacgaccaccagaactcctgatacctccacaatgcacctggca
acctcgagaactccagcctccctgtctggacccatgaccgccagccctctcctggtgcta
ttcacaattaacttcaccatcactaacctgcggtatgaggagaacatgcatcaccctggc
tctagaaagtttaacaccacggagagagtccttcagggtctgctcaggcctgtgttcaag
aacaccagtgttggccctctgtactctggctgcagactgaccttgctcaggcccaagaag
gatggggcagccaccaaagtggatgccatctgcacctaccgccctgatcccaaaagccct
ggactggacagagagcagctatactgggagctgagccagctgacccacagcatcactgag
ctgggcccctacaccctggacagggacagtctctatgtcaatggtttcacacagcggagc
tctgtgcccaccactagcattcctgggacccccacagtggacctgggaacatctgggact
ccagtttctaaacctggtccctcggctgccagccctctcctggtgctattcactctcaac
ttcaccatcaccaacctgcggtatgaggagaacatgcagcaccctggctccaggaagttc
aacaccacggagagggtccttcagggcctgctcaggtccctgttcaagagcaccagtgtt
ggccctctgtactctggctgcagactgactttgctcaggcctgaaaaggatgggacagcc
actggagtggatgccatctgcacccaccaccctgaccccaaaagccctaggctggacaga
gagcagctgtattgggagctgagccagctgacccacaatatcactgagctgggcccctat
gccctggacaacgacagcctctttgtcaatggtttcactcatcggagctctgtgtccacc
accagcactcctgggacccccacagtgtatctgggagcatctaagactccagcctcgata
tttggcccttcagctgccagccatctcctgatactattcaccctcaacttcaccatcact
aacctgcggtatgaggagaacatgtggcctggctccaggaagttcaacactacagagagg
gtccttcagggcctgctaaggcccttgttcaagaacaccagtgttggccctctgtactct
ggctgcaggctgaccttgctcaggccagagaaagatggggaagccaccggagtggatgcc
atctgcacccaccgccctgaccccacaggccctgggctggacagagagcagctgtatttg
gagctgagccagctgacccacagcatcactgagctgggcccctacacactggacagggac
agtctctatgtcaatggtttcacccatcggagctctgtacccaccaccagcaccggggtg
gtcagcgaggagccattcacactgaacttcaccatcaacaacctgcgctacatggcggac
atgggccaacccggctccctcaagttcaacatcacagacaacgtcatgcagcacctgctc
agtcctttgttccagaggagcagcctgggtgcacggtacacaggctgcagggtcatcgca
ctaaggtctgtgaagaacggtgctgagacacgggtggacctcctctgcacctacctgcag
cccctcagcggcccaggtctgcctatcaagcaggtgttccatgagctgagccagcagacc
catggcatcacccggctgggcccctactctctggacaaagacagcctctaccttaacggt
tacaatgaacctggtccagatgagcctcctacaactcccaagccagccaccacattcctg
cctcctctgtcagaagccacaacagccatggggtaccacctgaagaccctcacactcaac
ttcaccatctccaatctccagtattcaccagatatgggcaagggctcagctacattcaac
tccaccgagggggtccttcagcacctgctcagacccttgttccagaagagcagcatgggc
cccttctacttgggttgccaactgatctccctcaggcctgagaaggatggggcagccact
ggtgtggacaccacctgcacctaccaccctgaccctgtgggccccgggctggacatacag
cagctttactgggagctgagtcagctgacccatggtgtcacccaactgggcttctatgtc
ctggacagggatagcctcttcatcaatggctatgcaccccagaatttatcaatccggggc
gagtaccagataaatttccacattgtcaactggaacctcagtaatccagaccccacatcc
tcagagtacatcaccctgctgagggacatccaggacaaggtcaccacactctacaaaggc
agtcaactacatgacacattccgcttctgcctggtcaccaacttgacgatggactccgtg
ttggtcactgtcaaggcattgttctcctccaatttggaccccagcctggtggagcaagtc
tttctagataagaccctgaatgcctcattccattggctgggctccacctaccagttggtg
gacatccatgtgacagaaatggagtcatcagtttatcaaccaacaagcagctccagcacc
cagcacttctacctgaatttcaccatcaccaacctaccatattcccaggacaaagcccag
ccaggcaccaccaattaccagaggaacaaaaggaatattgaggatgcgctcaaccaactc
ttccgaaacagcagcatcaagagttatttttctgactgtcaagtttcaacattcaggtct
gtccccaacaggcaccacaccggggtggactccctgtgtaacttctcgccactggctcgg
agagtagacagagttgccatctatgaggaatttctgcggatgacccggaatggtacccag
ctgcagaacttcaccctggacaggagcagtgtccttgtggatgggtattctcccaacaga
aatgagcccttaactgggaattctgaccttcccttctgggctgtcatcctcatcggcttg
gcaggactcctgggagtcatcacatgcctgatctgcggtgtcctggtgaccacccgccgg
cggaagaaggaaggagaatacaacgtccagcaacagtgcccaggctactaccagtcacac
ctagacctggaggatctgcaatga

DBGET integrated database retrieval system