KEGG   Homo sapiens (human): 941Help
Entry
941               CDS       T01001                                 

Gene name
CD80, B7, B7-1, B7.1, BB1, CD28LG, CD28LG1, LAB7
Definition
(RefSeq) CD80 molecule
  KO
K05412  CD80 antigen
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules (CAMs)
hsa04620  Toll-like receptor signaling pathway
hsa04672  Intestinal immune network for IgA production
hsa04940  Type I diabetes mellitus
hsa05320  Autoimmune thyroid disease
hsa05322  Systemic lupus erythematosus
hsa05323  Rheumatoid arthritis
hsa05330  Allograft rejection
hsa05332  Graft-versus-host disease
hsa05416  Viral myocarditis
Drug target
Abatacept: D03203
Belatacept: D03222
Galiximab: D04295
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    941 (CD80)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    941 (CD80)
   04672 Intestinal immune network for IgA production
    941 (CD80)
 Human Diseases
  Immune diseases
   05322 Systemic lupus erythematosus
    941 (CD80)
   05323 Rheumatoid arthritis
    941 (CD80)
   05320 Autoimmune thyroid disease
    941 (CD80)
   05330 Allograft rejection
    941 (CD80)
   05332 Graft-versus-host disease
    941 (CD80)
  Cardiovascular diseases
   05416 Viral myocarditis
    941 (CD80)
  Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    941 (CD80)
CD molecules [BR:hsa04090]
 Proteins
  941 (CD80)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: C2-set_2 V-set Ig_3 I-set ig Ig_2
Motif
Other DBs
NCBI-GeneID: 941
NCBI-ProteinID: NP_005182
OMIM: 112203
HGNC: 1700
Ensembl: ENSG00000121594
Vega: OTTHUMG00000159419
Pharos: P33681(Tclin)
UniProt: P33681 A0N0P2
Structure
PDB: 

Jmol
Position
3q13.33
AA seq 288 aa AA seqDB search
MGHTRRQGTSPSKCPYLNFFQLLVLAGLSHFCSGVIHVTKEVKEVATLSCGHNVSVEELA
QTRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLK
YEKDAFKREHLAEVTLSVKADFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLSWLENGE
ELNAINTTVSQDPETELYAVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTTKQEHFP
DNLLPSWAITLISVNGIFVICCLTYCFAPRCRERRRNERLRRESVRPV
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgggccacacacggaggcagggaacatcaccatccaagtgtccatacctcaatttcttt
cagctcttggtgctggctggtctttctcacttctgttcaggtgttatccacgtgaccaag
gaagtgaaagaagtggcaacgctgtcctgtggtcacaatgtttctgttgaagagctggca
caaactcgcatctactggcaaaaggagaagaaaatggtgctgactatgatgtctggggac
atgaatatatggcccgagtacaagaaccggaccatctttgatatcactaataacctctcc
attgtgatcctggctctgcgcccatctgacgagggcacatacgagtgtgttgttctgaag
tatgaaaaagacgctttcaagcgggaacacctggctgaagtgacgttatcagtcaaagct
gacttccctacacctagtatatctgactttgaaattccaacttctaatattagaaggata
atttgctcaacctctggaggttttccagagcctcacctctcctggttggaaaatggagaa
gaattaaatgccatcaacacaacagtttcccaagatcctgaaactgagctctatgctgtt
agcagcaaactggatttcaatatgacaaccaaccacagcttcatgtgtctcatcaagtat
ggacatttaagagtgaatcagaccttcaactggaatacaaccaagcaagagcattttcct
gataacctgctcccatcctgggccattaccttaatctcagtaaatggaatttttgtgata
tgctgcctgacctactgctttgccccaagatgcagagagagaaggaggaatgagagattg
agaagggaaagtgtacgccctgtataa

DBGET integrated database retrieval system