KEGG   Homo sapiens (human): 942Help
Entry
942               CDS       T01001                                 

Gene name
CD86, B7-2, B7.2, B70, CD28LG2, LAB72
Definition
CD86 molecule
Orthology
K05413  
CD86 antigen
Organism
hsa  Homo sapiens (human)
Pathway
Cell adhesion molecules (CAMs)
Toll-like receptor signaling pathway
Intestinal immune network for IgA production
Type I diabetes mellitus
Transcriptional misregulation in cancer
Autoimmune thyroid disease
Systemic lupus erythematosus
Rheumatoid arthritis
Allograft rejection
Graft-versus-host disease
Viral myocarditis
Drug target
Abatacept: 
Class
Environmental Information Processing; Signaling molecules and interaction; Cell adhesion molecules (CAMs) [PATH:hsa04514]
Organismal Systems; Immune system; Toll-like receptor signaling pathway [PATH:hsa04620]
Organismal Systems; Immune system; Intestinal immune network for IgA production [PATH:hsa04672]
Human Diseases; Cancers; Transcriptional misregulation in cancers [PATH:hsa05202]
Human Diseases; Immune diseases; Systemic lupus erythematosus [PATH:hsa05322]
Human Diseases; Immune diseases; Rheumatoid arthritis [PATH:hsa05323]
Human Diseases; Immune diseases; Autoimmune thyroid disease [PATH:hsa05320]
Human Diseases; Immune diseases; Allograft rejection [PATH:hsa05330]
Human Diseases; Immune diseases; Graft-versus-host disease [PATH:hsa05332]
Human Diseases; Cardiovascular diseases; Viral myocarditis [PATH:hsa05416]
Human Diseases; Endocrine and metabolic diseases; Type I diabetes mellitus [PATH:hsa04940]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3q21
AA seq 217 aa AA seqDB search
MDPQCTMGLSNILFVMAFLLSANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKMSVL
LRTKNSTIEYDGIMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKTRLLSSPF
SIELEDPQPPPDHIPWITAVLPTVIICVMVFCLILWKWKKKKRPRNSYKCGTNTMEREES
EQTKKREKIHIPERSDEAQRVFKSSKTSSCDKSDTCF
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggatccccagtgcactatgggactgagtaacattctctttgtgatggccttcctgctc
tctgctaacttcagtcaacctgaaatagtaccaatttctaatataacagaaaatgtgtac
ataaatttgacctgctcatctatacacggttacccagaacctaagaagatgagtgttttg
ctaagaaccaagaattcaactatcgagtatgatggtattatgcagaaatctcaagataat
gtcacagaactgtacgacgtttccatcagcttgtctgtttcattccctgatgttacgagc
aatatgaccatcttctgtattctggaaactgacaagacgcggcttttatcttcacctttc
tctatagagcttgaggaccctcagcctcccccagaccacattccttggattacagctgta
cttccaacagttattatatgtgtgatggttttctgtctaattctatggaaatggaagaag
aagaagcggcctcgcaactcttataaatgtggaaccaacacaatggagagggaagagagt
gaacagaccaagaaaagagaaaaaatccatatacctgaaagatctgatgaagcccagcgt
gtttttaaaagttcgaagacatcttcatgcgacaaaagtgatacatgtttttaa

DBGET integrated database retrieval system