KEGG   Homo sapiens (human): 942Help
Entry
942               CDS       T01001                                 

Gene name
CD86, B7-2, B7.2, B70, CD28LG2, LAB72
Definition
CD86 molecule
Orthology
K05413  
CD86 antigen
Organism
hsa  Homo sapiens (human)
Pathway
Cell adhesion molecules (CAMs)
Toll-like receptor signaling pathway
Intestinal immune network for IgA production
Type I diabetes mellitus
Transcriptional misregulation in cancer
Autoimmune thyroid disease
Systemic lupus erythematosus
Rheumatoid arthritis
Allograft rejection
Graft-versus-host disease
Viral myocarditis
Drug target
Abatacept: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    942 (CD86)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    942 (CD86)
   04672 Intestinal immune network for IgA production
    942 (CD86)
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    942 (CD86)
  Immune diseases
   05322 Systemic lupus erythematosus
    942 (CD86)
   05323 Rheumatoid arthritis
    942 (CD86)
   05320 Autoimmune thyroid disease
    942 (CD86)
   05330 Allograft rejection
    942 (CD86)
   05332 Graft-versus-host disease
    942 (CD86)
  Cardiovascular diseases
   05416 Viral myocarditis
    942 (CD86)
  Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    942 (CD86)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   942 (CD86)
Cellular antigens [BR:hsa04090]
 Proteins
  942 (CD86)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3q21
AA seq 217 aa AA seqDB search
MDPQCTMGLSNILFVMAFLLSANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKMSVL
LRTKNSTIEYDGIMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKTRLLSSPF
SIELEDPQPPPDHIPWITAVLPTVIICVMVFCLILWKWKKKKRPRNSYKCGTNTMEREES
EQTKKREKIHIPERSDEAQRVFKSSKTSSCDKSDTCF
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggatccccagtgcactatgggactgagtaacattctctttgtgatggccttcctgctc
tctgctaacttcagtcaacctgaaatagtaccaatttctaatataacagaaaatgtgtac
ataaatttgacctgctcatctatacacggttacccagaacctaagaagatgagtgttttg
ctaagaaccaagaattcaactatcgagtatgatggtattatgcagaaatctcaagataat
gtcacagaactgtacgacgtttccatcagcttgtctgtttcattccctgatgttacgagc
aatatgaccatcttctgtattctggaaactgacaagacgcggcttttatcttcacctttc
tctatagagcttgaggaccctcagcctcccccagaccacattccttggattacagctgta
cttccaacagttattatatgtgtgatggttttctgtctaattctatggaaatggaagaag
aagaagcggcctcgcaactcttataaatgtggaaccaacacaatggagagggaagagagt
gaacagaccaagaaaagagaaaaaatccatatacctgaaagatctgatgaagcccagcgt
gtttttaaaagttcgaagacatcttcatgcgacaaaagtgatacatgtttttaa

DBGET integrated database retrieval system