KEGG   Homo sapiens (human): 945Help
Entry
945               CDS       T01001                                 

Gene name
CD33, SIGLEC-3, SIGLEC3, p67
Definition
(RefSeq) CD33 molecule
  KO
K06473  
CD33 antigen
Organism
hsa  Homo sapiens (human)
Pathway
Hematopoietic cell lineage
Drug target
Gemtuzumab: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    945 (CD33)
Cellular antigens [BR:hsa04090]
 Proteins
  945 (CD33)
Lectins [BR:hsa04091]
 I-type lectins (Siglecs)
  945 (CD33)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P20138(Tclin)
UniProt: 
Structure
PDB: 

Jmol
Position
19q13.41
AA seq 364 aa AA seqDB search
MPLLLLLPLLWAGALAMDPNFWLQVQESVTVQEGLCVLVPCTFFHPIPYYDKNSPVHGYW
FREGAIISRDSPVATNKLDQEVQEETQGRFRLLGDPSRNNCSLSIVDARRRDNGSYFFRM
ERGSTKYSYKSPQLSVHVTDLTHRPKILIPGTLEPGHSKNLTCSVSWACEQGTPPIFSWL
SAAPTSLGPRTTHSSVLIITPRPQDHGTNLTCQVKFAGAGVTTERTIQLNVTYVPQNPTT
GIFPGDGSGKQETRAGVVHGAIGGAGVTALLALCLCLIFFIVKTHRRKAARTAVGRNDTH
PTTGSASPKHQKKSKLHGPTETSSCSGAAPTVEMDEELHYASLNFHGMNPSKDTSTEYSE
VRTQ
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgccgctgctgctactgctgcccctgctgtgggcaggggccctggctatggatccaaat
ttctggctgcaagtgcaggagtcagtgacggtacaggagggtttgtgcgtcctcgtgccc
tgcactttcttccatcccataccctactacgacaagaactccccagttcatggttactgg
ttccgggaaggagccattatatccagggactctccagtggccacaaacaagctagatcaa
gaagtacaggaggagactcagggcagattccgcctccttggggatcccagtaggaacaac
tgctccctgagcatcgtagacgccaggaggagggataatggttcatacttctttcggatg
gagagaggaagtaccaaatacagttacaaatctccccagctctctgtgcatgtgacagac
ttgacccacaggcccaaaatcctcatccctggcactctagaacccggccactccaaaaac
ctgacctgctctgtgtcctgggcctgtgagcagggaacacccccgatcttctcctggttg
tcagctgcccccacctccctgggccccaggactactcactcctcggtgctcataatcacc
ccacggccccaggaccacggcaccaacctgacctgtcaggtgaagttcgctggagctggt
gtgactacggagagaaccatccagctcaacgtcacctatgttccacagaacccaacaact
ggtatctttccaggagatggctcagggaaacaagagaccagagcaggagtggttcatggg
gccattggaggagctggtgttacagccctgctcgctctttgtctctgcctcatcttcttc
atagtgaagacccacaggaggaaagcagccaggacagcagtgggcaggaatgacacccac
cctaccacagggtcagcctccccgaaacaccagaagaagtccaagttacatggccccact
gaaacctcaagctgttcaggtgccgcccctactgtggagatggatgaggagctgcattat
gcttccctcaactttcatgggatgaatccttccaaggacacctccaccgaatactcagag
gtcaggacccagtga

DBGET integrated database retrieval system