KEGG   Homo sapiens (human): 9459Help
Entry
9459              CDS       T01001                                 

Gene name
ARHGEF6, COOL2, Cool-2, MRX46, PIXA, alpha-PIX, alphaPIX
Definition
Rac/Cdc42 guanine nucleotide exchange factor (GEF) 6
Orthology
K05729  
Rho guanine nucleotide exchange factor 6
Organism
hsa  Homo sapiens (human)
Pathway
Regulation of actin cytoskeleton
Pancreatic cancer
Disease
H00480  
Non-syndromic X-linked mental retardation
Class
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:hsa04810]
Human Diseases; Cancers; Pancreatic cancer [PATH:hsa05212]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
Xq26.3
AA seq 776 aa AA seqDB search
MNPEEQIVTWLISLGVLESPKKTICDPEEFLKSSLKNGVVLCKLINRLMPGSVEKFCLDP
QTEADCINNINDFLKGCATLQVEIFDPDDLYSGVNFSKVLSTLLAVNKATEDQLSERPCG
RSSSLSAANTSQTNPQGAVSSTVSGLQRQSKTVEMTENGSHQLIVKARFNFKQTNEDELS
VCKGDIIYVTRVEEGGWWEGTLNGRTGWFPSNYVREIKSSERPLSPKAVKGFETAPLTKN
YYTVVLQNILDTEKEYAKELQSLLVTYLRPLQSNNNLSTVEVTSLLGNFEEVCTFQQTLC
QALEECSKFPENQHKVGGCLLSLMPHFKSMYLAYCANHPSAVNVLTQHSDELEQFMENQG
ASSPGILILTTNLSKPFMRLEKYVTLLQELERHMEDTHPDHQDILKAIVAFKTLMGQCQD
LRKRKQLELQILSEPIQAWEGEDIKNLGNVIFMSQVMVQYGACEEKEERYLMLFSNVLIM
LSASPRMSGFIYQGKIPIAGTVVTRLDEIEGNDCTFEITGNTVERIVVHCNNNQDFQEWL
EQLNRLIRGPASCSSLSKTSSSSCSAHSSFSSTGQPRGPLEPPQIIKPWSLSCLRPAPPL
RPSAALGYKERMSYILKESSKSPKTMKKFLHKRKTERKPSEEEYVIRKSTAALEEDAQIL
KVIEAYCTSANFQQGHGSSTRKDSIPQVLLPEEEKLIIEETRSNGQTIMEEKSLVDTVYA
LKDEVRELKQENKRMKQCLEEELKSRRDLEKLVRRLLKQTDECIRGESSSKTSILP
NT seq 2331 nt NT seq  +upstreamnt  +downstreamnt
atgaatccagaagaacaaatcgtgacatggcttatatctttgggagttttagagtcccct
aaaaagaccatctgtgatccggaggagtttttaaagtcctcgctgaaaaatggggtagtt
ctgtgcaaactgatcaacagactcatgcctggctctgtggaaaagttttgtctggatccc
caaactgaagctgactgcatcaacaacatcaatgacttcctgaaaggatgtgcaaccctc
caagtggaaatatttgatcctgatgacctttattcaggggtcaatttctccaaggtactg
agtactcttttagctgtcaacaaagcaacagaagatcagctatcagaaagaccatgtgga
cgttcctcttctcttagtgctgctaatacttctcagacaaacccacagggagcagtttct
agcacagtttcagggctgcaaaggcagtcaaagacagtggagatgacggaaaatggaagt
catcagttgatagtaaaagcaagattcaactttaagcagactaatgaggatgaactgtca
gtttgtaagggggacatcatttacgtcacacgagttgaagaaggaggctggtgggaaggc
acattaaatgggagaacaggctggttccccagtaattatgtccgtgaaattaaatccagt
gagagacctctctccccaaaagccgtcaaaggatttgaaactgctccacttaccaagaat
tattatactgtggtgttacagaacatcctggacactgaaaaagaatatgctaaagaactt
cagtctcttcttgttacttacttaagacccctgcagtccaataacaatctgagtactgtg
gaggttacatctttactgggaaacttcgaggaagtatgcacatttcaacagacactctgc
caagccttggaagaatgttcaaagtttccagaaaaccagcacaaagtaggaggttgtcta
ctgagtctcatgcctcattttaaatctatgtatctggcttactgtgcaaaccatccttca
gctgtaaatgtgctcactcagcacagtgatgagttggaacaattcatggaaaatcaaggt
gcatcgagcccaggtatcctcattttaacaacaaacctcagcaaaccattcatgcgactg
gagaaatatgttactctcttgcaagagttagaacggcatatggaggatactcatccagat
catcaggatattctgaaagcaatcgtagcattcaaaactctcatggggcaatgtcaagat
ctgaggaagagaaaacagctggagttacagatactgtccgaacctattcaggcatgggaa
ggagaagatattaaaaacttgggaaatgtgatttttatgtcacaagtaatggtgcagtat
ggagcatgtgaggaaaaagaggagcggtaccttatgttattttcaaatgtcctgataatg
ttatctgcaagtcctcggatgagtggctttatctatcagggaaaaataccaatagcagga
acggtggtgactagattagatgaaattgaagggaatgactgcacatttgaaatcactggt
aacacagtggagagaattgtggtccattgtaacaacaaccaggacttccaggaatggttg
gagcagctgaacagactgatcagaggacctgcctcttgcagttcattatccaaaacctca
tcgtcatcatgtagtgctcattcttcttttagctctaccggacagccccgaggacccttg
gagcctcctcaaattataaaaccgtggagtttaagttgtctacgacctgcacctccactt
agaccatcagcagcactaggttataaagagaggatgtcttatatcttaaaggagtctagt
aaaagccctaaaacgatgaagaaatttcttcataaaaggaagactgagagaaaaccatcg
gaggaggaatatgtgattaggaaaagtacagctgctctggaagaggatgctcaaatcctt
aaagtgatcgaagcctactgcaccagcgcaaattttcaacaaggccatggctcaagtact
cgaaaagattccattccacaagtcctactccctgaggaagagaaactcatcattgaagaa
accagaagcaacggccagaccatcatggaagaaaagagccttgttgatactgtttacgcc
ttgaaggacgaggtcagagaactgaagcaggaaaataaaagaatgaagcaatgcctggaa
gaagaactgaaatcaagaagggacctagaaaagctggtgcggaggcttttgaagcaaaca
gatgagtgtattcgaggcgagtccagtagcaagacctcaattcttccataa

DBGET integrated database retrieval system