KEGG   Homo sapiens (human): 9459Help
Entry
9459              CDS       T01001                                 

Gene name
ARHGEF6, COOL2, Cool-2, MRX46, PIXA, alpha-PIX, alphaPIX
Definition
(RefSeq) Rac/Cdc42 guanine nucleotide exchange factor (GEF) 6
  KO
K05729  
Rho guanine nucleotide exchange factor 6
Organism
hsa  Homo sapiens (human)
Pathway
Regulation of actin cytoskeleton
Pancreatic cancer
Disease
H00480  
Non-syndromic X-linked mental retardation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    9459 (ARHGEF6)
 Human Diseases
  Cancers
   05212 Pancreatic cancer
    9459 (ARHGEF6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
Xq26.3
AA seq 622 aa AA seqDB search
MTENGSHQLIVKARFNFKQTNEDELSVCKGDIIYVTRVEEGGWWEGTLNGRTGWFPSNYV
REIKSSERPLSPKAVKGFETAPLTKNYYTVVLQNILDTEKEYAKELQSLLVTYLRPLQSN
NNLSTVEVTSLLGNFEEVCTFQQTLCQALEECSKFPENQHKVGGCLLSLMPHFKSMYLAY
CANHPSAVNVLTQHSDELEQFMENQGASSPGILILTTNLSKPFMRLEKYVTLLQELERHM
EDTHPDHQDILKAIVAFKTLMGQCQDLRKRKQLELQILSEPIQAWEGEDIKNLGNVIFMS
QVMVQYGACEEKEERYLMLFSNVLIMLSASPRMSGFIYQGKIPIAGTVVTRLDEIEGNDC
TFEITGNTVERIVVHCNNNQDFQEWLEQLNRLIRGPASCSSLSKTSSSSCSAHSSFSSTG
QPRGPLEPPQIIKPWSLSCLRPAPPLRPSAALGYKERMSYILKESSKSPKTMKKFLHKRK
TERKPSEEEYVIRKSTAALEEDAQILKVIEAYCTSANFQQGHGSSTRKDSIPQVLLPEEE
KLIIEETRSNGQTIMEEKSLVDTVYALKDEVRELKQENKRMKQCLEEELKSRRDLEKLVR
RLLKQTDECIRGESSSKTSILP
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgacggaaaatggaagtcatcagttgatagtaaaagcaagattcaactttaagcagact
aatgaggatgaactgtcagtttgtaagggggacatcatttacgtcacacgagttgaagaa
ggaggctggtgggaaggcacattaaatgggagaacaggctggttccccagtaattatgtc
cgtgaaattaaatccagtgagagacctctctccccaaaagccgtcaaaggatttgaaact
gctccacttaccaagaattattatactgtggtgttacagaacatcctggacactgaaaaa
gaatatgctaaagaacttcagtctcttcttgttacttacttaagacccctgcagtccaat
aacaatctgagtactgtggaggttacatctttactgggaaacttcgaggaagtatgcaca
tttcaacagacactctgccaagccttggaagaatgttcaaagtttccagaaaaccagcac
aaagtaggaggttgtctactgagtctcatgcctcattttaaatctatgtatctggcttac
tgtgcaaaccatccttcagctgtaaatgtgctcactcagcacagtgatgagttggaacaa
ttcatggaaaatcaaggtgcatcgagcccaggtatcctcattttaacaacaaacctcagc
aaaccattcatgcgactggagaaatatgttactctcttgcaagagttagaacggcatatg
gaggatactcatccagatcatcaggatattctgaaagcaatcgtagcattcaaaactctc
atggggcaatgtcaagatctgaggaagagaaaacagctggagttacagatactgtccgaa
cctattcaggcatgggaaggagaagatattaaaaacttgggaaatgtgatttttatgtca
caagtaatggtgcagtatggagcatgtgaggaaaaagaggagcggtaccttatgttattt
tcaaatgtcctgataatgttatctgcaagtcctcggatgagtggctttatctatcaggga
aaaataccaatagcaggaacggtggtgactagattagatgaaattgaagggaatgactgc
acatttgaaatcactggtaacacagtggagagaattgtggtccattgtaacaacaaccag
gacttccaggaatggttggagcagctgaacagactgatcagaggacctgcctcttgcagt
tcattatccaaaacctcatcgtcatcatgtagtgctcattcttcttttagctctaccgga
cagccccgaggacccttggagcctcctcaaattataaaaccgtggagtttaagttgtcta
cgacctgcacctccacttagaccatcagcagcactaggttataaagagaggatgtcttat
atcttaaaggagtctagtaaaagccctaaaacgatgaagaaatttcttcataaaaggaag
actgagagaaaaccatcggaggaggaatatgtgattaggaaaagtacagctgctctggaa
gaggatgctcaaatccttaaagtgatcgaagcctactgcaccagcgcaaattttcaacaa
ggccatggctcaagtactcgaaaagattccattccacaagtcctactccctgaggaagag
aaactcatcattgaagaaaccagaagcaacggccagaccatcatggaagaaaagagcctt
gttgatactgtttacgccttgaaggacgaggtcagagaactgaagcaggaaaataaaaga
atgaagcaatgcctggaagaagaactgaaatcaagaagggacctagaaaagctggtgcgg
aggcttttgaagcaaacagatgagtgtattcgaggcgagtccagtagcaagacctcaatt
cttccataa

DBGET integrated database retrieval system