KEGG   Homo sapiens (human): 9491Help
Entry
9491              CDS       T01001                                 

Gene name
PSMF1, PI31
Definition
(RefSeq) proteasome inhibitor subunit 1
  KO
K06700  
proteasome inhibitor subunit 1 (PI31)
Organism
hsa  Homo sapiens (human)
Pathway
Proteasome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03050 Proteasome
    9491 (PSMF1)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Regulatory particles
   PI31
    9491 (PSMF1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   9491 (PSMF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q92530(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
20p13
AA seq 271 aa AA seqDB search
MAGLEVLFASAAPAITCRQDALVCFLHWEVVTHGYFGLGVGDQPGPNDKKSELLPAGWNN
NKDLYVLRYEYKDGSRKLLVKAITVESSMILNVLEYGSQQVADLTLNLDDYIDAEHLGDF
HRTYKNSEELRSRIVSGIITPIHEQWEKANVSSPHREFPPATAREVDPLRIPPHHPHTSR
QPPWCDPLGPFVVGGEDLDPFGPRRGGMIVDPLRSGFPRALIDPSSGLPNRLPPGAVPPG
ARFDPFGPIGTSPPGPNPDHLPPPGYDDMYL
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcctggaggtactgttcgcatcggcagcgccggccatcacctgcaggcaggac
gcgctcgtctgcttcttgcattgggaagtggtgacacacggttacttcggcttgggtgtc
ggtgaccagccgggtcccaatgataagaagtcagaactgctgccagctgggtggaacaac
aataaagacctgtatgtcctccggtatgagtataaggatgggtccagaaagctccttgtg
aaagccatcaccgtggagagcagcatgatcctcaatgtgctggaatatggctcacagcaa
gtggcagacttgaccctgaacttggatgattatatcgatgcagaacacctgggtgacttc
cacaggacctacaagaacagtgaggagcttcggtctcgtattgtgtctggaatcatcaca
cctatccatgagcagtgggaaaaggctaatgtaagcagtccccaccgggagttcccccct
gctaccgccagagaggtggacccactccggattcctccacaccacccacacaccagtcgg
cagcctccctggtgtgatcccctgggcccgtttgttgtcgggggagaagacttagaccct
tttgggcctcggagaggtggcatgattgtggatcccctgagatctggcttcccaagagca
cttattgacccttcctcaggcctcccgaaccgacttcctccaggcgctgtgcccccagga
gctcgctttgacccctttggacccattgggaccagcccacccggacctaacccagaccat
ctccccccgccgggctacgatgacatgtacctgtga

DBGET integrated database retrieval system