KEGG   Homo sapiens (human): 952Help
Entry
952               CDS       T01001                                 

Gene name
CD38, ADPRC_1, ADPRC1
Definition
(RefSeq) CD38 molecule (EC:3.2.2.6 2.4.99.20)
  KO
K01242  
ADP-ribosyl cyclase 1 [EC:3.2.2.6 2.4.99.20]
Organism
hsa  Homo sapiens (human)
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Calcium signaling pathway
Hematopoietic cell lineage
Oxytocin signaling pathway
Salivary secretion
Pancreatic secretion
Epstein-Barr virus infection
Drug target
Daratumumab: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    952 (CD38)
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    952 (CD38)
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    952 (CD38)
  Endocrine system
   04921 Oxytocin signaling pathway
    952 (CD38)
  Digestive system
   04970 Salivary secretion
    952 (CD38)
   04972 Pancreatic secretion
    952 (CD38)
 Human Diseases
  Infectious diseases
   05169 Epstein-Barr virus infection
    952 (CD38)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.20  2'-phospho-ADP-ribosyl cyclase/2'-phospho-cyclic-ADP-ribose transferase
     952 (CD38)
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.6  ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase
     952 (CD38)
Cell adhesion molecules and their ligands [BR:hsa04516]
 1. Immunoglobulin Superfamily
  Others
   PECAM1, CD31; platelet/endothelial cell adhesion molecule [KO:K06471]
    952 (CD38)
Cellular antigens [BR:hsa04090]
 Proteins
  952 (CD38)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Hyaluronan
  Cell surface receptors
   952 (CD38)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
4p15
AA seq 300 aa AA seqDB search
MANCEFSPVSGDKPCCRLSRRAQLCLGVSILVLILVVVLAVVVPRWRQQWSGPGTTKRFP
ETVLARCVKYTEIHPEMRHVDCQSVWDAFKGAFISKHPCNITEEDYQPLMKLGTQTVPCN
KILLWSRIKDLAHQFTQVQRDMFTLEDTLLGYLADDLTWCGEFNTSKINYQSCPDWRKDC
SNNPVSVFWKTVSRRFAEAACDVVHVMLNGSRSKIFDKNSTFGSVEVHNLQPEKVQTLEA
WVIHGGREDSRDLCQDPTIKELESIISKRNIQFSCKNIYRPDKFLQCVKNPEDSSCTSEI
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atggccaactgcgagttcagcccggtgtccggggacaaaccctgctgccggctctctagg
agagcccaactctgtcttggcgtcagtatcctggtcctgatcctcgtcgtggtgctcgcg
gtggtcgtcccgaggtggcgccagcagtggagcggtccgggcaccaccaagcgctttccc
gagaccgtcctggcgcgatgcgtcaagtacactgaaattcatcctgagatgagacatgta
gactgccaaagtgtatgggatgctttcaagggtgcatttatttcaaaacatccttgcaac
attactgaagaagactatcagccactaatgaagttgggaactcagaccgtaccttgcaac
aagattcttctttggagcagaataaaagatctggcccatcagttcacacaggtccagcgg
gacatgttcaccctggaggacacgctgctaggctaccttgctgatgacctcacatggtgt
ggtgaattcaacacttccaaaataaactatcaatcttgcccagactggagaaaggactgc
agcaacaaccctgtttcagtattctggaaaacggtttcccgcaggtttgcagaagctgcc
tgtgatgtggtccatgtgatgctcaatggatcccgcagtaaaatctttgacaaaaacagc
acttttgggagtgtggaagtccataatttgcaaccagagaaggttcagacactagaggcc
tgggtgatacatggtggaagagaagattccagagacttatgccaggatcccaccataaaa
gagctggaatcgattataagcaaaaggaatattcaattttcctgcaagaatatctacaga
cctgacaagtttcttcagtgtgtgaaaaatcctgaggattcatcttgcacatctgagatc
tga

DBGET integrated database retrieval system