KEGG   Homo sapiens (human): 9520Help
Entry
9520              CDS       T01001                                 

Gene name
NPEPPS, AAP-S, MP100, PSA
Definition
(RefSeq) aminopeptidase puromycin sensitive (EC:3.4.11.14)
  KO
K08776  
puromycin-sensitive aminopeptidase [EC:3.4.11.-]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     9520 (NPEPPS)
Peptidases [BR:hsa01002]
 Metallo Peptidases
  Family M1
   9520 (NPEPPS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17q21
AA seq 919 aa AA seqDB search
MWLAAAAPSLARRLLFLGPPPPPLLLLVFSRSSRRRLHSLGLAAMPEKRPFERLPADVSP
INYSLCLKPDLLDFTFEGKLEAAAQVRQATNQIVMNCADIDIITASYAPEGDEEIHATGF
NYQNEDEKVTLSFPSTLQTGTGTLKIDFVGELNDKMKGFYRSKYTTPSGEVRYAAVTQFE
ATDARRAFPCWDEPAIKATFDISLVVPKDRVALSNMNVIDRKPYPDDENLVEVKFARTPV
MSTYLVAFVVGEYDFVETRSKDGVCVRVYTPVGKAEQGKFALEVAAKTLPFYKDYFNVPY
PLPKIDLIAIADFAAGAMENWGLVTYRETALLIDPKNSCSSSRQWVALVVGHELAHQWFG
NLVTMEWWTHLWLNEGFASWIEYLCVDHCFPEYDIWTQFVSADYTRAQELDALDNSHPIE
VSVGHPSEVDEIFDAISYSKGASVIRMLHDYIGDKDFKKGMNMYLTKFQQKNAATEDLWE
SLENASGKPIAAVMNTWTKQMGFPLIYVEAEQVEDDRLLRLSQKKFCAGGSYVGEDCPQW
MVPITISTSEDPNQAKLKILMDKPEMNVVLKNVKPDQWVKLNLGTVGFYRTQYSSAMLES
LLPGIRDLSLPPVDRLGLQNDLFSLARAGIISTVEVLKVMEAFVNEPNYTVWSDLSCNLG
ILSTLLSHTDFYEEIQEFVKDVFSPIGERLGWDPKPGEGHLDALLRGLVLGKLGKAGHKA
TLEEARRRFKDHVEGKQILSADLRSPVYLTVLKHGDGTTLDIMLKLHKQADMQEEKNRIE
RVLGATLLPDLIQKVLTFALSEEVRPQDTVSVIGGVAGGSKHGRKAAWKFIKDNWEELYN
RYQGGFLISRLIKLSVEGFAVDKMAGEVKAFFESHPAPSAERTIQQCCENILLNAAWLKR
DAESIHQYLLQRKASPPTV
NT seq 2760 nt NT seq  +upstreamnt  +downstreamnt
atgtggctggcagctgccgccccctccctcgctcgccgcctgctcttcctcggccctccg
cctcctcccctcctccttctcgtcttcagccgctcctctcgccgccgcctccacagcctg
ggcctcgccgcgatgccggagaagaggcccttcgagcggctgcctgccgatgtctccccc
atcaactacagcctttgcctcaagcccgacttgctggacttcaccttcgagggcaagctg
gaggccgccgcccaggtgaggcaggcgactaatcagattgtgatgaattgtgctgatatt
gatattattacagcttcatatgcaccagaaggagatgaagaaatacatgctacaggattt
aactatcagaatgaagatgaaaaagtcaccttgtctttccctagtactctgcaaacaggt
acgggaaccttaaagatagattttgttggagagctgaatgacaaaatgaaaggtttctat
agaagtaaatatactaccccttctggagaggtgcgctatgctgctgtaacacagtttgag
gctactgatgcccgaagggcttttccttgctgggatgagcctgctatcaaagcaactttt
gatatctcattggttgttcctaaagacagagtagctttatcaaacatgaatgtaattgac
cggaaaccataccctgatgatgaaaatttagtggaagtgaagtttgcccgcacacctgtt
atgtctacatatctggtggcatttgttgtgggtgaatatgactttgtagaaacaaggtca
aaagatggtgtgtgtgtccgtgtttacactcctgttggcaaagcagagcaaggaaaattt
gcgttagaggttgctgctaaaaccttgcctttttataaggactacttcaatgttccttat
cctctacctaaaattgatctcattgctattgcagactttgcagctggtgccatggagaac
tggggccttgttacttatagggagactgcattgcttattgatccaaaaaattcctgttct
tcatcccgccagtgggttgctctggttgtgggacatgaactcgcccatcaatggtttgga
aatcttgttactatggaatggtggactcatctttggttaaatgaaggttttgcatcctgg
attgaatatctgtgtgtagaccactgcttcccagagtatgatatttggactcagtttgtt
tctgctgattacacccgtgcccaggagcttgacgccttagataacagccatcctattgaa
gtcagtgtgggccatccatctgaggttgatgagatatttgatgctatatcatatagcaaa
ggtgcatctgtcatccgaatgctgcatgactacattggggataaggactttaagaaagga
atgaacatgtatttaaccaagttccaacaaaagaatgctgccacagaggatctctgggaa
agtttagaaaatgctagtggtaaacctatagcagctgtgatgaatacctggaccaaacaa
atgggatttcccctcatttatgtggaagctgaacaggtagaagatgacagattattgagg
ttgtcccaaaagaagttctgtgctggtgggtcatatgttggtgaagattgtccccagtgg
atggtccctatcacaatctctactagtgaagaccccaaccaggccaaactaaaaattcta
atggacaagccagagatgaatgtggttttgaaaaatgtcaaaccagaccaatgggtgaag
ttaaacttaggaacagttgggttttatcggacccagtacagctctgccatgctggaaagt
ttattaccaggcattcgtgacctttctctgccccctgtggatcgacttggattacagaat
gacctcttctccttggctcgagctggaatcattagcactgtagaggttctaaaagtcatg
gaggcttttgtgaatgagcccaattatactgtatggagcgacctgagctgtaacctgggg
attctctcaactctcttgtcccacacagacttctatgaggaaatccaggagtttgtgaaa
gatgtcttttcacctataggggagagactgggctgggaccccaaacctggagaaggtcat
ctcgatgcactcctgaggggcttggttctgggaaaactaggaaaagcaggacataaggca
acgttagaagaagcccgtcgtcggtttaaggaccacgtggaaggaaaacagattctctcc
gctgatctgaggagtcctgtctatctgactgttttgaagcatggtgatggcactacttta
gatattatgttaaaacttcataaacaagcagatatgcaagaagagaaaaaccgaatcgaa
agagtccttggcgctactcttttgcctgacctgattcaaaaagtcctcacgtttgcactt
tcagaagaggtacgtccacaggacactgtatcggtaattggtggagtagctggaggcagc
aagcatggtaggaaagctgcttggaaattcataaaggacaactgggaagaactttataac
cgataccagggaggattcttaatatccagactaataaagctatcagttgagggatttgca
gttgataaaatggctggagaggttaaggctttcttcgagagtcacccagctccttcagct
gagcgtaccatccagcagtgttgtgaaaatattctgctgaatgctgcctggctaaagcga
gatgctgagagcatccaccagtacctccttcagcggaaggcctcaccacccacagtgtga

DBGET integrated database retrieval system