KEGG   Homo sapiens (human): 9555Help
Entry
9555              CDS       T01001                                 

Gene name
H2AFY, H2A.y, H2A/y, H2AF12M, MACROH2A1.1, mH2A1, macroH2A1.2
Definition
(RefSeq) H2A histone family member Y
  KO
K11251  
histone H2A
Organism
hsa  Homo sapiens (human)
Pathway
Alcoholism
Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Immune diseases
   05322 Systemic lupus erythematosus
    9555 (H2AFY)
  Substance dependence
   05034 Alcoholism
    9555 (H2AFY)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    9555 (H2AFY)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   9555 (H2AFY)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
5q31.1
AA seq 372 aa AA seqDB search
MSSRGGKKKSTKTSRSAKAGVIFPVGRMLRYIKKGHPKYRIGVGAPVYMAAVLEYLTAEI
LELAGNAARDNKKGRVTPRHILLAVANDEELNQLLKGVTIASGGVLPNIHPELLAKKRGS
KGKLEAIITPPPAKKAKSPSQKKPVSKKAGGKKGARKSKKKQGEVSKAASADSTTEGTPA
DGFTVLSTKSLFLGQKLNLIHSEISNLAGFEVEAIINPTNADIDLKDDLGNTLEKKGGKE
FVEAVLELRKKNGPLEVAGAAVSAGHGLPAKFVIHCNSPVWGADKCEELLEKTVKNCLAL
ADDKKLKSIAFPSIGSGRNGFPKQTAAQLILKAISSYFVSTMSSSIKTVYFVLFDSESIG
IYVQEMAKLDAN
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagccgcggtgggaagaagaagtccaccaagacgtccaggtctgccaaagcagga
gtcatctttcccgtggggcggatgctgcggtacatcaagaaaggccaccccaagtacagg
attggagtgggggcacccgtgtacatggccgccgtcctggaatacctgacagcggagatt
ctggagctggctggcaatgcagcgagagacaacaagaagggacgggtcacaccccggcac
atcctgctggctgtggccaatgatgaagagctgaatcagctgctaaaaggagtcaccata
gccagtgggggtgtgttacccaacatccaccccgagttgctagcgaagaagcggggatcc
aaaggaaagttggaagccatcatcacaccacccccagccaaaaaggccaagtctccatcc
cagaagaagcctgtatctaaaaaagcaggaggcaagaaaggggcccggaaatccaagaag
aagcagggtgaagtcagtaaggcagccagcgccgacagcacaaccgagggcacacctgcc
gacggcttcacagtcctctccaccaagagcctcttccttggccagaagctgaaccttatt
cacagtgaaatcagtaatttagccggctttgaggtggaggccataatcaatcctaccaat
gctgacattgaccttaaagatgacctaggaaacacgctggagaagaaaggtggcaaggag
tttgtggaagctgtcctggaactccggaaaaagaacgggcccttggaagtagctggagct
gctgtcagcgcaggccatggcctgcctgccaagtttgtgatccactgtaatagtccagtt
tggggtgcagacaagtgtgaagaacttctggaaaagacagtgaaaaactgcttggccctg
gctgatgataagaagctgaaatccattgcatttccatccatcggcagcggcaggaacggt
tttccaaagcagacagcagctcagctgattctgaaggccatctccagttacttcgtgtct
acaatgtcctcttccatcaaaacggtgtacttcgtgctttttgacagcgagagtataggc
atctatgtgcaggaaatggccaagctggacgccaactag

DBGET integrated database retrieval system