KEGG   Homo sapiens (human): 9555Help
Entry
9555              CDS       T01001                                 

Gene name
H2AFY, H2A.y, H2A/y, H2AF12M, H2AFJ, MACROH2A1.1, mH2A1, macroH2A1.2
Definition
H2A histone family, member Y
Orthology
K11251  
histone H2A
Organism
hsa  Homo sapiens (human)
Pathway
Alcoholism
Systemic lupus erythematosus
Class
Human Diseases; Immune diseases; Systemic lupus erythematosus [PATH:hsa05322]
Human Diseases; Substance dependence; Alcoholism [PATH:hsa05034]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
5q31.1
AA seq 371 aa AA seqDB search
MSSRGGKKKSTKTSRSAKAGVIFPVGRMLRYIKKGHPKYRIGVGAPVYMAAVLEYLTAEI
LELAGNAARDNKKGRVTPRHILLAVANDEELNQLLKGVTIASGGVLPNIHPELLAKKRGS
KGKLEAIITPPPAKKAKSPSQKKPVSKKAGGKKGARKSKKQGEVSKAASADSTTEGTPAD
GFTVLSTKSLFLGQKLNLIHSEISNLAGFEVEAIINPTNADIDLKDDLGNTLEKKGGKEF
VEAVLELRKKNGPLEVAGAAVSAGHGLPAKFVIHCNSPVWGADKCEELLEKTVKNCLALA
DDKKLKSIAFPSIGSGRNGFPKQTAAQLILKAISSYFVSTMSSSIKTVYFVLFDSESIGI
YVQEMAKLDAN
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagccgcggtgggaagaagaagtccaccaagacgtccaggtctgccaaagcagga
gtcatctttcccgtggggcggatgctgcggtacatcaagaaaggccaccccaagtacagg
attggagtgggggcacccgtgtacatggccgccgtcctggaatacctgacagcggagatt
ctggagctggctggcaatgcagcgagagacaacaagaagggacgggtcacaccccggcac
atcctgctggctgtggccaatgatgaagagctgaatcagctgctaaaaggagtcaccata
gccagtgggggtgtgttacccaacatccaccccgagttgctagcgaagaagcggggatcc
aaaggaaagttggaagccatcatcacaccacccccagccaaaaaggccaagtctccatcc
cagaagaagcctgtatctaaaaaagcaggaggcaagaaaggggcccggaaatccaagaag
cagggtgaagtcagtaaggcagccagcgccgacagcacaaccgagggcacacctgccgac
ggcttcacagtcctctccaccaagagcctcttccttggccagaagctgaaccttattcac
agtgaaatcagtaatttagccggctttgaggtggaggccataatcaatcctaccaatgct
gacattgaccttaaagatgacctaggaaacacgctggagaagaaaggtggcaaggagttt
gtggaagctgtcctggaactccggaaaaagaacgggcccttggaagtagctggagctgct
gtcagcgcaggccatggcctgcctgccaagtttgtgatccactgtaatagtccagtttgg
ggtgcagacaagtgtgaagaacttctggaaaagacagtgaaaaactgcttggccctggct
gatgataagaagctgaaatccattgcatttccatccatcggcagcggcaggaacggtttt
ccaaagcagacagcagctcagctgattctgaaggccatctccagttacttcgtgtctaca
atgtcctcttccatcaaaacggtgtacttcgtgctttttgacagcgagagtataggcatc
tatgtgcaggaaatggccaagctggacgccaactag

DBGET integrated database retrieval system