KEGG   Homo sapiens (human): 9564Help
Entry
9564              CDS       T01001                                 

Gene name
BCAR1, CAS, CAS1, CASS1, CRKAS, P130Cas
Definition
(RefSeq) BCAR1, Cas family scaffolding protein
  KO
K05726  
breast cancer anti-estrogen resistance 1
Organism
hsa  Homo sapiens (human)
Pathway
Rap1 signaling pathway
Chemokine signaling pathway
Focal adhesion
Leukocyte transendothelial migration
Regulation of actin cytoskeleton
Bacterial invasion of epithelial cells
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    9564 (BCAR1)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    9564 (BCAR1)
  Cellular community - eukaryotes
   04510 Focal adhesion
    9564 (BCAR1)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    9564 (BCAR1)
   04062 Chemokine signaling pathway
    9564 (BCAR1)
 Human Diseases
  Infectious diseases
   05100 Bacterial invasion of epithelial cells
    9564 (BCAR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
16q23.1
AA seq 870 aa AA seqDB search
MSVPNVLAKALYDNVAESPDELSFRKGDIMTVLEQDTQGLDGWWLCSLHGRQGIVPGNRL
KILVGMYDKKPAGPGPGPPATPAQPQPGLHAPAPPASQYTPMLPNTYQPQPDSVYLVPTP
SKAQQGLYQVPGPSPQFQSPPAKQTSTFSKQTPHHPFPSPATDLYQVPPGPGGPAQDIYQ
VPPSAGMGHDIYQVPPSMDTRSWEGTKPPAKVVVPTRVGQGYVYEAAQPEQDEYDIPRHL
LAPGPQDIYDVPPVRGLLPSQYGQEVYDTPPMAVKGPNGRDPLLEVYDVPPSVEKGLPPS
NHHAVYDVPPSVSKDVPDGPLLREETYDVPPAFAKAKPFDPARTPLVLAAPPPDSPPAED
VYDVPPPAPDLYDVPPGLRRPGPGTLYDVPRERVLPPEVADGGVVDSGVYAVPPPAEREA
PAEGKRLSASSTGSTRSSQSASSLEVAGPGREPLELEVAVEALARLQQGVSATVAHLLDL
AGSAGATGSWRSPSEPQEPLVQDLQAAVAAVQSAVHELLEFARSAVGNAAHTSDRALHAK
LSRQLQKMEDVHQTLVAHGQALDAGRGGSGATLEDLDRLVACSRAVPEDAKQLASFLHGN
ASLLFRRTKATAPGPEGGGTLHPNPTDKTSSIQSRPLPSPPKFTSQDSPDGQYENSEGGW
MEDYDYVHLQGKEEFEKTQKELLEKGSITRQGKSQLELQQLKQFERLEQEVSRPIDHDLA
NWTPAQPLAPGRTGGLGPSDRQLLLFYLEQCEANLTTLTNAVDAFFTAVATNQPPKIFVA
HSKFVILSAHKLVFIGDTLSRQAKAADVRSQVTHYSNLLCDLLRGIVATTKAAALQYPSP
SAAQDMVERVKELGHSTQQFRRVLGQLAAA
NT seq 2613 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtgcctaacgtgctggccaaagcgctctatgacaatgtggccgagtccccggat
gagctctccttccgcaagggtgacatcatgacggtgctggagcaggacacgcagggcctg
gacggctggtggctctgctcgctgcatgggcgccagggcatcgtgcctgggaaccgcctc
aagatcttggtgggcatgtatgataagaagccagcagggcctggccccggccctcccgcc
accccggcccagcctcagcctggcctccatgccccagcgcctccggcctcccagtacacg
cccatgctccccaacacctaccagccccagccagacagcgtctacctggtgcccactccc
agcaaggctcagcaaggcctctaccaagtcccgggtcccagccctcagttccagtctccc
ccagccaagcagacatccaccttctcgaagcagacaccccatcacccgtttcccagcccg
gccacagacctgtaccaggtgcccccagggcctggaggccctgcccaggatatttaccag
gtgccaccttctgccgggatggggcatgacatctaccaggtccccccgtccatggacaca
cgcagctgggagggcacgaagcccccggcaaaggtggtggtgcccacccgcgtggggcag
ggctatgtatacgaggccgcccagccggagcaggacgagtacgacatcccgcgacacctg
ctggccccggggccacaggacatctatgatgtgcccccggttcgggggctgcttcccagc
cagtatggccaggaggtgtatgacacaccccccatggctgtcaagggtcccaatggccga
gacccgttgctggaggtgtatgacgtgccccccagtgtggagaagggcctgccaccgtcc
aaccaccacgcagtctacgacgttcctccatcggtgagcaaggatgtgcccgatggccca
ctgctgcgtgaggagacctacgatgtgccccccgccttcgccaaggccaagccctttgac
ccggcccgcaccccactggtactggctgcgccccctccagactccccgccggccgaggac
gtgtatgacgtgccgcccccggctcctgacctctacgacgtgccccctggcttgcggcgg
cctggcccgggcaccctgtacgatgtgccccgtgaacgggtgcttcctcctgaggtggct
gatggtggcgtggtcgacagtggtgtgtatgcggtgcctcccccagctgaacgtgaagcc
ccggcagagggcaagcgcctgtcggcctccagcaccggcagcacacgcagcagccagtct
gcgtcctccttggaggtggcagggccgggccgggaacccctggagctggaagttgctgtg
gaggccctggcacggctgcagcagggtgtgagcgccaccgttgcccaccttctggacctg
gcaggcagcgccggtgcgactgggagctggcgtagcccctctgagccacaggagccgctg
gtgcaggacctgcaggctgctgtggccgctgtccagagtgccgtccacgagctgttggag
tttgcccgcagcgcggtgggcaatgctgcccacacatctgaccgtgccctgcatgccaag
cttagccggcagctgcagaagatggaggacgtgcaccagacgctggtggcacatggtcag
gccctcgacgctggccggggaggctctggagccacccttgaggacctggaccggctggtg
gcctgctcgcgggctgtgcccgaggacgccaagcagctggcctccttcctgcacggcaat
gcctcactgctcttcagacggaccaaggccactgccccggggcctgaggggggtggcacc
ctgcaccccaaccccactgacaagaccagcagcatccagtcacgacccctgccctcaccc
cctaagttcacctcccaggactcgccagatgggcagtacgagaacagcgaggggggctgg
atggaggactatgactacgtccacctacaggggaaggaggagtttgagaagacccagaag
gagctgctggaaaagggcagcatcacgcggcagggcaagagccagctggagttgcagcag
ctgaagcagtttgaacgactggaacaggaggtgtcacggcccatagaccacgacctggcc
aactggacgccagcccaacccctggccccggggcgaacaggcggcctggggccctcggac
cggcagctgctgctcttctacctggagcagtgtgaggccaacctgaccacactgaccaac
gccgtggacgccttctttaccgccgtggccaccaaccagccgcccaagatctttgtggcg
cacagcaagttcgtcatcctcagcgcccacaagctggtgttcatcggggacacactgtca
cggcaggccaaggctgctgacgtgcgcagccaggtgacccactacagcaacctgctgtgc
gacctcctgcgcggcatcgtggccaccaccaaggccgctgccttgcagtacccatcgcct
tccgcggcccaggacatggtggagagggtcaaggagctgggccacagcacccagcagttc
cgccgcgtcctaggccagctggcagccgcctga

DBGET integrated database retrieval system