KEGG   Homo sapiens (human): 9564Help
Entry
9564              CDS       T01001                                 

Gene name
BCAR1, CAS, CAS1, CASS1, CRKAS, P130Cas
Definition
breast cancer anti-estrogen resistance 1
Orthology
K05726  
breast cancer anti-estrogen resistance 1
Organism
hsa  Homo sapiens (human)
Pathway
Rap1 signaling pathway
Chemokine signaling pathway
Focal adhesion
Leukocyte transendothelial migration
Regulation of actin cytoskeleton
Bacterial invasion of epithelial cells
Class
Environmental Information Processing; Signal transduction; Rap1 signaling pathway [PATH:hsa04015]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:hsa04810]
Cellular Processes; Cell communication; Focal adhesion [PATH:hsa04510]
Organismal Systems; Immune system; Leukocyte transendothelial migration [PATH:hsa04670]
Organismal Systems; Immune system; Chemokine signaling pathway [PATH:hsa04062]
Human Diseases; Infectious diseases; Bacterial invasion of epithelial cells [PATH:hsa05100]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
16q23.1
AA seq 916 aa AA seqDB search
MPAKPFLSSVLLSWKVLDFSGPGPQGTGQPCSCGHWAEGQGGPPEPAGGPNVLAKALYDN
VAESPDELSFRKGDIMTVLEQDTQGLDGWWLCSLHGRQGIVPGNRLKILVGMYDKKPAGP
GPGPPATPAQPQPGLHAPAPPASQYTPMLPNTYQPQPDSVYLVPTPSKAQQGLYQVPGPS
PQFQSPPAKQTSTFSKQTPHHPFPSPATDLYQVPPGPGGPAQDIYQVPPSAGMGHDIYQV
PPSMDTRSWEGTKPPAKVVVPTRVGQGYVYEAAQPEQDEYDIPRHLLAPGPQDIYDVPPV
RGLLPSQYGQEVYDTPPMAVKGPNGRDPLLEVYDVPPSVEKGLPPSNHHAVYDVPPSVSK
DVPDGPLLREETYDVPPAFAKAKPFDPARTPLVLAAPPPDSPPAEDVYDVPPPAPDLYDV
PPGLRRPGPGTLYDVPRERVLPPEVADGGVVDSGVYAVPPPAEREAPAEGKRLSASSTGS
TRSSQSASSLEVAGPGREPLELEVAVEALARLQQGVSATVAHLLDLAGSAGATGSWRSPS
EPQEPLVQDLQAAVAAVQSAVHELLEFARSAVGNAAHTSDRALHAKLSRQLQKMEDVHQT
LVAHGQALDAGRGGSGATLEDLDRLVACSRAVPEDAKQLASFLHGNASLLFRRTKATAPG
PEGGGTLHPNPTDKTSSIQSRPLPSPPKFTSQDSPDGQYENSEGGWMEDYDYVHLQGKEE
FEKTQKELLEKGSITRQGKSQLELQQLKQFERLEQEVSRPIDHDLANWTPAQPLAPGRTG
GLGPSDRQLLLFYLEQCEANLTTLTNAVDAFFTAVATNQPPKIFVAHSKFVILSAHKLVF
IGDTLSRQAKAADVRSQVTHYSNLLCDLLRGIVATTKAAALQYPSPSAAQDMVERVKELG
HSTQQFRRVLGQLAAA
NT seq 2751 nt NT seq  +upstreamnt  +downstreamnt
atgcctgccaagcccttcctctcttctgttctgctctcctggaaagttctggacttctct
ggcccagggcctcaggggactggccagccctgctcctgtgggcactgggcagagggacaa
ggcggaccacctgagcctgctggagggccgaacgtgctggccaaagcgctctatgacaat
gtggccgagtccccggatgagctctccttccgcaagggtgacatcatgacggtgctggag
caggacacgcagggcctggacggctggtggctctgctcgctgcatgggcgccagggcatc
gtgcctgggaaccgcctcaagatcttggtgggcatgtatgataagaagccagcagggcct
ggccccggccctcccgccaccccggcccagcctcagcctggcctccatgccccagcgcct
ccggcctcccagtacacgcccatgctccccaacacctaccagccccagccagacagcgtc
tacctggtgcccactcccagcaaggctcagcaaggcctctaccaagtcccgggtcccagc
cctcagttccagtctcccccagccaagcagacatccaccttctcgaagcagacaccccat
cacccgtttcccagcccggccacagacctgtaccaggtgcccccagggcctggaggccct
gcccaggatatttaccaggtgccaccttctgccgggatggggcatgacatctaccaggtc
cccccgtccatggacacacgcagctgggagggcacgaagcccccggcaaaggtggtggtg
cccacccgcgtggggcagggctatgtatacgaggccgcccagccggagcaggacgagtac
gacatcccgcgacacctgctggccccggggccacaggacatctatgatgtgcccccggtt
cgggggctgcttcccagccagtatggccaggaggtgtatgacacaccccccatggctgtc
aagggtcccaatggccgagacccgttgctggaggtgtatgacgtgccccccagtgtggag
aagggcctgccaccgtccaaccaccacgcagtctacgacgttcctccatcggtgagcaag
gatgtgcccgatggcccactgctgcgtgaggagacctacgatgtgccccccgccttcgcc
aaggccaagccctttgacccggcccgcaccccactggtactggctgcgccccctccagac
tccccgccggccgaggacgtgtatgacgtgccgcccccggctcctgacctctacgacgtg
ccccctggcttgcggcggcctggcccgggcaccctgtacgatgtgccccgtgaacgggtg
cttcctcctgaggtggctgatggtggcgtggtcgacagtggtgtgtatgcggtgcctccc
ccagctgaacgtgaagccccggcagagggcaagcgcctgtcggcctccagcaccggcagc
acacgcagcagccagtctgcgtcctccttggaggtggcagggccgggccgggaacccctg
gagctggaagttgctgtggaggccctggcacggctgcagcagggtgtgagcgccaccgtt
gcccaccttctggacctggcaggcagcgccggtgcgactgggagctggcgtagcccctct
gagccacaggagccgctggtgcaggacctgcaggctgctgtggccgctgtccagagtgcc
gtccacgagctgttggagtttgcccgcagcgcggtgggcaatgctgcccacacatctgac
cgtgccctgcatgccaagcttagccggcagctgcagaagatggaggacgtgcaccagacg
ctggtggcacatggtcaggccctcgacgctggccggggaggctctggagccacccttgag
gacctggaccggctggtggcctgctcgcgggctgtgcccgaggacgccaagcagctggcc
tccttcctgcacggcaatgcctcactgctcttcagacggaccaaggccactgccccgggg
cctgaggggggtggcaccctgcaccccaaccccactgacaagaccagcagcatccagtca
cgacccctgccctcaccccctaagttcacctcccaggactcgccagatgggcagtacgag
aacagcgaggggggctggatggaggactatgactacgtccacctacaggggaaggaggag
tttgagaagacccagaaggagctgctggaaaagggcagcatcacgcggcagggcaagagc
cagctggagttgcagcagctgaagcagtttgaacgactggaacaggaggtgtcacggccc
atagaccacgacctggccaactggacgccagcccaacccctggccccggggcgaacaggc
ggcctggggccctcggaccggcagctgctgctcttctacctggagcagtgtgaggccaac
ctgaccacactgaccaacgccgtggacgccttctttaccgccgtggccaccaaccagccg
cccaagatctttgtggcgcacagcaagttcgtcatcctcagcgcccacaagctggtgttc
atcggggacacactgtcacggcaggccaaggctgctgacgtgcgcagccaggtgacccac
tacagcaacctgctgtgcgacctcctgcgcggcatcgtggccaccaccaaggccgctgcc
ttgcagtacccatcgccttccgcggcccaggacatggtggagagggtcaaggagctgggc
cacagcacccagcagttccgccgcgtcctaggccagctggcagccgcctga

DBGET integrated database retrieval system