KEGG   Homo sapiens (human): 9575Help
Entry
9575              CDS       T01001                                 

Gene name
CLOCK, KAT13D, bHLHe8
Definition
clock circadian regulator (EC:2.3.1.48)
Orthology
K02223  
circadian locomoter output cycles kaput protein [EC:2.3.1.48]
Organism
hsa  Homo sapiens (human)
Pathway
Circadian rhythm
Dopaminergic synapse
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Nervous system
   04728 Dopaminergic synapse
    9575 (CLOCK)
  Environmental adaptation
   04710 Circadian rhythm
    9575 (CLOCK)
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    9575 (CLOCK)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     9575 (CLOCK)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    9575 (CLOCK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
4q12
AA seq 846 aa AA seqDB search
MLFTVSCSKMSSIVDRDDSSIFDGLVEEDDKDKAKRVSRNKSEKKRRDQFNVLIKELGSM
LPGNARKMDKSTVLQKSIDFLRKHKEITAQSDASEIRQDWKPTFLSNEEFTQLMLEALDG
FFLAIMTDGSIIYVSESVTSLLEHLPSDLVDQSIFNFIPEGEHSEVYKILSTHLLESDSL
TPEYLKSKNQLEFCCHMLRGTIDPKEPSTYEYVKFIGNFKSLNSVSSSAHNGFEGTIQRT
HRPSYEDRVCFVATVRLATPQFIKEMCTVEEPNEEFTSRHSLEWKFLFLDHRAPPIIGYL
PFEVLGTSGYDYYHVDDLENLAKCHEHLMQYGKGKSCYYRFLTKGQQWIWLQTHYYITYH
QWNSRPEFIVCTHTVVSYAEVRAERRRELGIEESLPETAADKSQDSGSDNRINTVSLKEA
LERFDHSPTPSASSRSSRKSSHTAVSDPSSTPTKIPTDTSTPPRQHLPAHEKMVQRRSSF
SSQSINSQSVGSSLTQPVMSQATNLPIPQGMSQFQFSAQLGAMQHLKDQLEQRTRMIEAN
IHRQQEELRKIQEQLQMVHGQGLQMFLQQSNPGLNFGSVQLSSGNSSNIQQLAPINMQGQ
VVPTNQIQSGMNTGHIGTTQHMIQQQTLQSTSTQSQQNVLSGHSQQTSLPSQTQSTLTAP
LYNTMVISQPAAGSMVQIPSSMPQNSTQSAAVTTFTQDRQIRFSQGQQLVTKLVTAPVAC
GAVMVPSTMLMGQVVTAYPTFATQQQQSQTLSVTQQQQQQSSQEQQLTSVQQPSQAQLTQ
PPQQFLQTSRLLHGNPSTQLILSAAFPLQQSTFPQSHHQQHQSQQQQQLSRHRTDSLPDP
SKVQPQ
NT seq 2541 nt NT seq  +upstreamnt  +downstreamnt
atgttgtttaccgtaagctgtagtaaaatgagctcgattgttgacagagatgacagtagt
atttttgatgggttggtggaagaagatgacaaggacaaagcgaaaagagtatctagaaac
aaatctgaaaagaaacgtagagatcaatttaatgttctcattaaagaactgggatccatg
cttcctggtaatgctagaaagatggacaaatctactgttctgcagaaaagcattgatttt
ttacgaaaacataaagaaatcactgcacagtcagatgctagtgaaattcgacaggactgg
aaacctacattccttagtaatgaagagtttacacaattaatgttagaggctcttgatggt
ttttttttagcaatcatgacagatggaagcataatatatgtgtctgagagtgtaacttca
ttacttgaacatttaccatctgatcttgtggatcaaagtatatttaattttatcccagaa
ggggaacattcagaggtttataaaatactctctactcatctgctggaaagtgattcatta
accccagaatatttaaaatcaaaaaatcagttagaattctgttgtcacatgctgcgagga
acaatagacccaaaggagccatctacctatgaatatgtaaaatttataggaaatttcaaa
tctttaaacagtgtatcctcttcagcacacaatggttttgaaggaactatacaacgcaca
cataggccatcttatgaagatagagtttgttttgtagctactgtcaggttagctacacct
cagttcatcaaggaaatgtgcactgttgaagaacccaatgaagagtttacatctagacat
agtttagaatggaagtttctgtttctagatcacagggcaccacccataatagggtatttg
ccatttgaagttctgggaacatcaggctatgattactatcatgtggatgacctagaaaat
ttggcaaaatgtcatgagcacttaatgcaatatgggaaaggcaaatcatgttattatagg
ttcctgactaaggggcaacagtggatttggcttcagactcattattatatcacttaccat
cagtggaattcaaggccagagtttattgtttgtactcacactgtagtaagttatgcagaa
gttagggctgaaagacgacgagaacttggcattgaagagtctcttcctgagacagctgct
gacaaaagccaagattctgggtcagataatcgtataaacacagtcagtctcaaggaagca
ttggaaaggtttgatcacagcccaaccccttctgcctcttctcggagttcaagaaaatca
tctcacacggccgtctcagacccttcctcaacaccaaccaagatcccgacggatacgagc
actccacccaggcagcatttaccagctcatgagaagatggtgcaaagaaggtcatcattt
agtagtcagtccataaattcccagtctgttggttcatcattaacacagccagtgatgtct
caagctacaaatttaccaattccacaaggcatgtcccagtttcagttttcagctcaatta
ggagccatgcaacatctgaaagaccaattggaacaacggacacgcatgatagaagcaaat
attcatcggcaacaagaagaactaagaaaaattcaagaacaacttcagatggtccatggt
caggggctgcagatgtttttgcaacaatcaaatcctgggttgaattttggttccgttcaa
ctttcttctggaaattcatctaatatccagcaacttgcacctataaatatgcaaggccaa
gttgttcctactaaccagattcaaagtggaatgaatactggacacattggcacaactcag
cacatgatacaacaacagactttacagagtacatcaactcagagtcaacaaaatgtactg
agtgggcacagtcagcaaacatctctacccagtcagacacagagcactcttacagcccca
ctgtataacactatggtgatttctcagcctgcagccggaagcatggtccagattccatct
agtatgccacaaaacagcacccagagtgctgcagtaactacattcactcaggacaggcag
ataagattttctcaaggtcaacaacttgtgaccaaattagtgactgctcctgtagcttgt
ggggcagtcatggtacctagtactatgcttatgggccaggtggtgactgcatatcctact
tttgctacacaacagcaacagtcacagacattgtcagtaacgcagcagcagcagcagcag
agctcccaggagcagcagctcacttcagttcagcaaccatctcaggctcagctgacccag
ccaccgcaacaatttttacagacttctaggttgctccatgggaatccctcaactcaactc
attctctctgctgcatttcctctacaacagagcaccttccctcagtcacatcaccagcaa
catcagtctcagcaacagcagcaactcagccggcacaggactgacagcttgcccgaccct
tccaaggttcaaccacagtag

DBGET integrated database retrieval system