KEGG   Homo sapiens (human): 959Help
Entry
959               CDS       T01001                                 

Gene name
CD40LG, CD154, CD40L, HIGM1, IGM, IMD3, T-BAM, TNFSF5, TRAP, gp39, hCD40L
Definition
CD40 ligand
Orthology
K03161  
tumor necrosis factor ligand superfamily member 5
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
NF-kappa B signaling pathway
Cell adhesion molecules (CAMs)
T cell receptor signaling pathway
Intestinal immune network for IgA production
Malaria
Toxoplasmosis
Asthma
Autoimmune thyroid disease
Systemic lupus erythematosus
Allograft rejection
Primary immunodeficiency
Viral myocarditis
Disease
H00093  
Combined immunodeficiencies (CIDs)
Drug target
Other: 
Class
Environmental Information Processing; Signal transduction; NF-kappa B signaling pathway [PATH:hsa04064]
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:hsa04060]
Environmental Information Processing; Signaling molecules and interaction; Cell adhesion molecules (CAMs) [PATH:hsa04514]
Organismal Systems; Immune system; T cell receptor signaling pathway [PATH:hsa04660]
Organismal Systems; Immune system; Intestinal immune network for IgA production [PATH:hsa04672]
Human Diseases; Immune diseases; Asthma [PATH:hsa05310]
Human Diseases; Immune diseases; Systemic lupus erythematosus [PATH:hsa05322]
Human Diseases; Immune diseases; Autoimmune thyroid disease [PATH:hsa05320]
Human Diseases; Immune diseases; Allograft rejection [PATH:hsa05330]
Human Diseases; Immune diseases; Primary immunodeficiency [PATH:hsa05340]
Human Diseases; Cardiovascular diseases; Viral myocarditis [PATH:hsa05416]
Human Diseases; Infectious diseases; Malaria [PATH:hsa05144]
Human Diseases; Infectious diseases; Toxoplasmosis [PATH:hsa05145]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
Xq26
AA seq 261 aa AA seqDB search
MIETYNQTSPRSAATGLPISMKIFMYLLTVFLITQMIGSALFAVYLHRRLDKIEDERNLH
EDFVFMKTIQRCNTGERSLSLLNCEEIKSQFEGFVKDIMLNKEETKKENSFEMQKGDQNP
QIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLENGKQLTVKRQGLYYIYAQVTFCSN
REASSQAPFIASLCLKSPGRFERILLRAANTHSSAKPCGQQSIHLGGVFELQPGASVFVN
VTDPSQVSHGTGFTSFGLLKL
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaaacatacaaccaaacttctccccgatctgcggccactggactgcccatcagc
atgaaaatttttatgtatttacttactgtttttcttatcacccagatgattgggtcagca
ctttttgctgtgtatcttcatagaaggttggacaagatagaagatgaaaggaatcttcat
gaagattttgtattcatgaaaacgatacagagatgcaacacaggagaaagatccttatcc
ttactgaactgtgaggagattaaaagccagtttgaaggctttgtgaaggatataatgtta
aacaaagaggagacgaagaaagaaaacagctttgaaatgcaaaaaggtgatcagaatcct
caaattgcggcacatgtcataagtgaggccagcagtaaaacaacatctgtgttacagtgg
gctgaaaaaggatactacaccatgagcaacaacttggtaaccctggaaaatgggaaacag
ctgaccgttaaaagacaaggactctattatatctatgcccaagtcaccttctgttccaat
cgggaagcttcgagtcaagctccatttatagccagcctctgcctaaagtcccccggtaga
ttcgagagaatcttactcagagctgcaaatacccacagttccgccaaaccttgcgggcaa
caatccattcacttgggaggagtatttgaattgcaaccaggtgcttcggtgtttgtcaat
gtgactgatccaagccaagtgagccatggcactggcttcacgtcctttggcttactcaaa
ctctga

DBGET integrated database retrieval system