KEGG   Homo sapiens (human): 959Help
Entry
959               CDS       T01001                                 

Gene name
CD40LG, CD154, CD40L, HIGM1, IGM, IMD3, T-BAM, TNFSF5, TRAP, gp39, hCD40L
Definition
CD40 ligand
Orthology
K03161  
tumor necrosis factor ligand superfamily member 5
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
NF-kappa B signaling pathway
Cell adhesion molecules (CAMs)
T cell receptor signaling pathway
Intestinal immune network for IgA production
Malaria
Toxoplasmosis
Asthma
Autoimmune thyroid disease
Systemic lupus erythematosus
Allograft rejection
Primary immunodeficiency
Viral myocarditis
Disease
H00093  
Combined immunodeficiencies (CIDs)
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04064 NF-kappa B signaling pathway
    959 (CD40LG)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    959 (CD40LG)
   04514 Cell adhesion molecules (CAMs)
    959 (CD40LG)
 Organismal Systems
  Immune system
   04660 T cell receptor signaling pathway
    959 (CD40LG)
   04672 Intestinal immune network for IgA production
    959 (CD40LG)
 Human Diseases
  Immune diseases
   05310 Asthma
    959 (CD40LG)
   05322 Systemic lupus erythematosus
    959 (CD40LG)
   05320 Autoimmune thyroid disease
    959 (CD40LG)
   05330 Allograft rejection
    959 (CD40LG)
   05340 Primary immunodeficiency
    959 (CD40LG)
  Cardiovascular diseases
   05416 Viral myocarditis
    959 (CD40LG)
  Infectious diseases
   05144 Malaria
    959 (CD40LG)
   05145 Toxoplasmosis
    959 (CD40LG)
Cellular antigens [BR:hsa04090]
 Proteins
  959 (CD40LG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
Xq26
AA seq 261 aa AA seqDB search
MIETYNQTSPRSAATGLPISMKIFMYLLTVFLITQMIGSALFAVYLHRRLDKIEDERNLH
EDFVFMKTIQRCNTGERSLSLLNCEEIKSQFEGFVKDIMLNKEETKKENSFEMQKGDQNP
QIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLENGKQLTVKRQGLYYIYAQVTFCSN
REASSQAPFIASLCLKSPGRFERILLRAANTHSSAKPCGQQSIHLGGVFELQPGASVFVN
VTDPSQVSHGTGFTSFGLLKL
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaaacatacaaccaaacttctccccgatctgcggccactggactgcccatcagc
atgaaaatttttatgtatttacttactgtttttcttatcacccagatgattgggtcagca
ctttttgctgtgtatcttcatagaaggttggacaagatagaagatgaaaggaatcttcat
gaagattttgtattcatgaaaacgatacagagatgcaacacaggagaaagatccttatcc
ttactgaactgtgaggagattaaaagccagtttgaaggctttgtgaaggatataatgtta
aacaaagaggagacgaagaaagaaaacagctttgaaatgcaaaaaggtgatcagaatcct
caaattgcggcacatgtcataagtgaggccagcagtaaaacaacatctgtgttacagtgg
gctgaaaaaggatactacaccatgagcaacaacttggtaaccctggaaaatgggaaacag
ctgaccgttaaaagacaaggactctattatatctatgcccaagtcaccttctgttccaat
cgggaagcttcgagtcaagctccatttatagccagcctctgcctaaagtcccccggtaga
ttcgagagaatcttactcagagctgcaaatacccacagttccgccaaaccttgcgggcaa
caatccattcacttgggaggagtatttgaattgcaaccaggtgcttcggtgtttgtcaat
gtgactgatccaagccaagtgagccatggcactggcttcacgtcctttggcttactcaaa
ctctga

DBGET integrated database retrieval system