KEGG   Homo sapiens (human): 960Help
Entry
960               CDS       T01001                                 

Gene name
CD44, CDW44, CSPG8, ECMR-III, HCELL, HUTCH-I, IN, LHR, MC56, MDU2, MDU3, MIC4, Pgp1
Definition
CD44 molecule (Indian blood group)
Orthology
K06256  
CD44 antigen
Organism
hsa  Homo sapiens (human)
Pathway
ECM-receptor interaction
Hematopoietic cell lineage
Shigellosis
Epstein-Barr virus infection
Proteoglycans in cancer
MicroRNAs in cancer
Disease
H00018  
Gastric cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    960 (CD44)
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    960 (CD44)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    960 (CD44)
   05205 Proteoglycans in cancer
    960 (CD44)
  Infectious diseases
   05131 Shigellosis
    960 (CD44)
   05169 Epstein-Barr virus infection
    960 (CD44)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   960 (CD44)
  Exosomal proteins of other body fluids (saliva and urine)
   960 (CD44)
  Exosomal proteins of colorectal cancer cells
   960 (CD44)
  Exosomal proteins of bladder cancer cells
   960 (CD44)
Cellular antigens [BR:hsa04090]
 Proteins
  960 (CD44)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11p13
AA seq 742 aa AA seqDB search
MDKFWWHAAWGLCLVPLSLAQIDLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTL
PTMAQMEKALSIGFETCRYGFIEGHVVIPRIHPNSICAANNTGVYILTSNTSQYDTYCFN
ASAPPEEDCTSVTDLPNAFDGPITITIVNRDGTRYVQKGEYRTNPEDIYPSNPTDDDVSS
GSSSERSSTSGGYIFYTFSTVHPIPDEDSPWITDSTDRIPATTLMSTSATATETATKRQE
TWDWFSWLFLPSESKNHLHTTTQMAGTSSNTISAGWEPNEENEDERDRHLSFSGSGIDDD
EDFISSTISTTPRAFDHTKQNQDWTQWNPSHSNPEVLLQTTTRMTDVDRNGTTAYEGNWN
PEAHPPLIHHEHHEEEETPHSTSTIQATPSSTTEETATQKEQWFGNRWHEGYRQTPKEDS
HSTTGTAAASAHTSHPMQGRTTPSPEDSSWTDFFNPISHPMGRGHQAGRRMDMDSSHSIT
LQPTANPNTGLVEDLDRTGPLSMTTQQSNSQSFSTSHEGLEEDKDHPTTSTLTSSNRNDV
TGGRRDPNHSEGSTTLLEGYTSHYPHTKESRTFIPVTSAKTGSFGVTAVTVGDSNSNVNR
SLSGDQDTFHPSGGSHTTHGSESDGHSHGSQEGGANTTSGPIRTPQIPEWLIILASLLAL
ALILAVCIAVNSRRRCGQKKKLVINSGNGAVEDRKPSGLNGEASKSQEMVHLVNKESSET
PDQFMTADETRNLQNVDMKIGV
NT seq 2229 nt NT seq  +upstreamnt  +downstreamnt
atggacaagttttggtggcacgcagcctggggactctgcctcgtgccgctgagcctggcg
cagatcgatttgaatataacctgccgctttgcaggtgtattccacgtggagaaaaatggt
cgctacagcatctctcggacggaggccgctgacctctgcaaggctttcaatagcaccttg
cccacaatggcccagatggagaaagctctgagcatcggatttgagacctgcaggtatggg
ttcatagaagggcacgtggtgattccccggatccaccccaactccatctgtgcagcaaac
aacacaggggtgtacatcctcacatccaacacctcccagtatgacacatattgcttcaat
gcttcagctccacctgaagaagattgtacatcagtcacagacctgcccaatgcctttgat
ggaccaattaccataactattgttaaccgtgatggcacccgctatgtccagaaaggagaa
tacagaacgaatcctgaagacatctaccccagcaaccctactgatgatgacgtgagcagc
ggctcctccagtgaaaggagcagcacttcaggaggttacatcttttacaccttttctact
gtacaccccatcccagacgaagacagtccctggatcaccgacagcacagacagaatccct
gctaccactttgatgagcactagtgctacagcaactgagacagcaaccaagaggcaagaa
acctgggattggttttcatggttgtttctaccatcagagtcaaagaatcatcttcacaca
acaacacaaatggctggtacgtcttcaaataccatctcagcaggctgggagccaaatgaa
gaaaatgaagatgaaagagacagacacctcagtttttctggatcaggcattgatgatgat
gaagattttatctccagcaccatttcaaccacaccacgggcttttgaccacacaaaacag
aaccaggactggacccagtggaacccaagccattcaaatccggaagtgctacttcagaca
accacaaggatgactgatgtagacagaaatggcaccactgcttatgaaggaaactggaac
ccagaagcacaccctcccctcattcaccatgagcatcatgaggaagaagagaccccacat
tctacaagcacaatccaggcaactcctagtagtacaacggaagaaacagctacccagaag
gaacagtggtttggcaacagatggcatgagggatatcgccaaacacccaaagaagactcc
cattcgacaacagggacagctgcagcctcagctcataccagccatccaatgcaaggaagg
acaacaccaagcccagaggacagttcctggactgatttcttcaacccaatctcacacccc
atgggacgaggtcatcaagcaggaagaaggatggatatggactccagtcatagtataacg
cttcagcctactgcaaatccaaacacaggtttggtggaagatttggacaggacaggacct
ctttcaatgacaacgcagcagagtaattctcagagcttctctacatcacatgaaggcttg
gaagaagataaagaccatccaacaacttctactctgacatcaagcaataggaatgatgtc
acaggtggaagaagagacccaaatcattctgaaggctcaactactttactggaaggttat
acctctcattacccacacacgaaggaaagcaggaccttcatcccagtgacctcagctaag
actgggtcctttggagttactgcagttactgttggagattccaactctaatgtcaatcgt
tccttatcaggagaccaagacacattccaccccagtggggggtcccataccactcatgga
tctgaatcagatggacactcacatgggagtcaagaaggtggagcaaacacaacctctggt
cctataaggacaccccaaattccagaatggctgatcatcttggcatccctcttggccttg
gctttgattcttgcagtttgcattgcagtcaacagtcgaagaaggtgtgggcagaagaaa
aagctagtgatcaacagtggcaatggagctgtggaggacagaaagccaagtggactcaac
ggagaggccagcaagtctcaggaaatggtgcatttggtgaacaaggagtcgtcagaaact
ccagaccagtttatgacagctgatgagacaaggaacctgcagaatgtggacatgaagatt
ggggtgtaa

DBGET integrated database retrieval system