KEGG   Homo sapiens (human): 960Help
Entry
960               CDS       T01001                                 

Gene name
CD44, CDW44, CSPG8, ECMR-III, HCELL, HUTCH-I, IN, LHR, MC56, MDU2, MDU3, MIC4, Pgp1
Definition
CD44 molecule (Indian blood group)
Orthology
K06256  
CD44 antigen
Organism
hsa  Homo sapiens (human)
Pathway
ECM-receptor interaction
Hematopoietic cell lineage
Shigellosis
Epstein-Barr virus infection
Proteoglycans in cancer
MicroRNAs in cancer
Disease
H00018  
Gastric cancer
Class
Environmental Information Processing; Signaling molecules and interaction; ECM-receptor interaction [PATH:hsa04512]
Organismal Systems; Immune system; Hematopoietic cell lineage [PATH:hsa04640]
Human Diseases; Cancers; MicroRNAs in cancer [PATH:hsa05206]
Human Diseases; Cancers; Proteoglycans in cancer [PATH:hsa05205]
Human Diseases; Infectious diseases; Shigellosis [PATH:hsa05131]
Human Diseases; Infectious diseases; Epstein-Barr virus infection [PATH:hsa05169]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11p13
AA seq 742 aa AA seqDB search
MDKFWWHAAWGLCLVPLSLAQIDLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTL
PTMAQMEKALSIGFETCRYGFIEGHVVIPRIHPNSICAANNTGVYILTSNTSQYDTYCFN
ASAPPEEDCTSVTDLPNAFDGPITITIVNRDGTRYVQKGEYRTNPEDIYPSNPTDDDVSS
GSSSERSSTSGGYIFYTFSTVHPIPDEDSPWITDSTDRIPATTLMSTSATATETATKRQE
TWDWFSWLFLPSESKNHLHTTTQMAGTSSNTISAGWEPNEENEDERDRHLSFSGSGIDDD
EDFISSTISTTPRAFDHTKQNQDWTQWNPSHSNPEVLLQTTTRMTDVDRNGTTAYEGNWN
PEAHPPLIHHEHHEEEETPHSTSTIQATPSSTTEETATQKEQWFGNRWHEGYRQTPKEDS
HSTTGTAAASAHTSHPMQGRTTPSPEDSSWTDFFNPISHPMGRGHQAGRRMDMDSSHSIT
LQPTANPNTGLVEDLDRTGPLSMTTQQSNSQSFSTSHEGLEEDKDHPTTSTLTSSNRNDV
TGGRRDPNHSEGSTTLLEGYTSHYPHTKESRTFIPVTSAKTGSFGVTAVTVGDSNSNVNR
SLSGDQDTFHPSGGSHTTHGSESDGHSHGSQEGGANTTSGPIRTPQIPEWLIILASLLAL
ALILAVCIAVNSRRRCGQKKKLVINSGNGAVEDRKPSGLNGEASKSQEMVHLVNKESSET
PDQFMTADETRNLQNVDMKIGV
NT seq 2229 nt NT seq  +upstreamnt  +downstreamnt
atggacaagttttggtggcacgcagcctggggactctgcctcgtgccgctgagcctggcg
cagatcgatttgaatataacctgccgctttgcaggtgtattccacgtggagaaaaatggt
cgctacagcatctctcggacggaggccgctgacctctgcaaggctttcaatagcaccttg
cccacaatggcccagatggagaaagctctgagcatcggatttgagacctgcaggtatggg
ttcatagaagggcacgtggtgattccccggatccaccccaactccatctgtgcagcaaac
aacacaggggtgtacatcctcacatccaacacctcccagtatgacacatattgcttcaat
gcttcagctccacctgaagaagattgtacatcagtcacagacctgcccaatgcctttgat
ggaccaattaccataactattgttaaccgtgatggcacccgctatgtccagaaaggagaa
tacagaacgaatcctgaagacatctaccccagcaaccctactgatgatgacgtgagcagc
ggctcctccagtgaaaggagcagcacttcaggaggttacatcttttacaccttttctact
gtacaccccatcccagacgaagacagtccctggatcaccgacagcacagacagaatccct
gctaccactttgatgagcactagtgctacagcaactgagacagcaaccaagaggcaagaa
acctgggattggttttcatggttgtttctaccatcagagtcaaagaatcatcttcacaca
acaacacaaatggctggtacgtcttcaaataccatctcagcaggctgggagccaaatgaa
gaaaatgaagatgaaagagacagacacctcagtttttctggatcaggcattgatgatgat
gaagattttatctccagcaccatttcaaccacaccacgggcttttgaccacacaaaacag
aaccaggactggacccagtggaacccaagccattcaaatccggaagtgctacttcagaca
accacaaggatgactgatgtagacagaaatggcaccactgcttatgaaggaaactggaac
ccagaagcacaccctcccctcattcaccatgagcatcatgaggaagaagagaccccacat
tctacaagcacaatccaggcaactcctagtagtacaacggaagaaacagctacccagaag
gaacagtggtttggcaacagatggcatgagggatatcgccaaacacccaaagaagactcc
cattcgacaacagggacagctgcagcctcagctcataccagccatccaatgcaaggaagg
acaacaccaagcccagaggacagttcctggactgatttcttcaacccaatctcacacccc
atgggacgaggtcatcaagcaggaagaaggatggatatggactccagtcatagtataacg
cttcagcctactgcaaatccaaacacaggtttggtggaagatttggacaggacaggacct
ctttcaatgacaacgcagcagagtaattctcagagcttctctacatcacatgaaggcttg
gaagaagataaagaccatccaacaacttctactctgacatcaagcaataggaatgatgtc
acaggtggaagaagagacccaaatcattctgaaggctcaactactttactggaaggttat
acctctcattacccacacacgaaggaaagcaggaccttcatcccagtgacctcagctaag
actgggtcctttggagttactgcagttactgttggagattccaactctaatgtcaatcgt
tccttatcaggagaccaagacacattccaccccagtggggggtcccataccactcatgga
tctgaatcagatggacactcacatgggagtcaagaaggtggagcaaacacaacctctggt
cctataaggacaccccaaattccagaatggctgatcatcttggcatccctcttggccttg
gctttgattcttgcagtttgcattgcagtcaacagtcgaagaaggtgtgggcagaagaaa
aagctagtgatcaacagtggcaatggagctgtggaggacagaaagccaagtggactcaac
ggagaggccagcaagtctcaggaaatggtgcatttggtgaacaaggagtcgtcagaaact
ccagaccagtttatgacagctgatgagacaaggaacctgcagaatgtggacatgaagatt
ggggtgtaa

DBGET integrated database retrieval system