KEGG   Homo sapiens (human): 9601Help
Entry
9601              CDS       T01001                                 

Gene name
PDIA4, ERP70, ERP72, ERp-72
Definition
protein disulfide isomerase family A, member 4 (EC:5.3.4.1)
Orthology
K09582  
protein disulfide-isomerase A4 [EC:5.3.4.1]
Organism
hsa  Homo sapiens (human)
Pathway
Protein processing in endoplasmic reticulum
Thyroid hormone synthesis
Vibrio cholerae infection
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:hsa04141]
Organismal Systems; Endocrine system; Thyroid hormone synthesis [PATH:hsa04918]
Human Diseases; Infectious diseases; Vibrio cholerae infection [PATH:hsa05110]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
7q35
AA seq 645 aa AA seqDB search
MRPRKAFLLLLLLGLVQLLAVAGAEGPDEDSSNRENAIEDEEEEEEEDDDEEEDDLEVKE
ENGVLVLNDANFDNFVADKDTVLLEFYAPWCGHCKQFAPEYEKIANILKDKDPPIPVAKI
DATSASVLASRFDVSGYPTIKILKKGQAVDYEGSRTQEEIVAKVREVSQPDWTPPPEVTL
VLTKENFDEVVNDADIILVEFYAPWCGHCKKLAPEYEKAAKELSKRSPPIPLAKVDATAE
TDLAKRFDVSGYPTLKIFRKGRPYDYNGPREKYGIVDYMIEQSGPPSKEILTLKQVQEFL
KDGDDVIIIGVFKGESDPAYQQYQDAANNLREDYKFHHTFSTEIAKFLKVSQGQLVVMQP
EKFQSKYEPRSHMMDVQGSTQDSAIKDFVLKYALPLVGHRKVSNDAKRYTRRPLVVVYYS
VDFSFDYRAATQFWRSKVLEVAKDFPEYTFAIADEEDYAGEVKDLGLSESGEDVNAAILD
ESGKKFAMEPEEFDSDTLREFVTAFKKGKLKPVIKSQPVPKNNKGPVKVVVGKTFDSIVM
DPKKDVLIEFYAPWCGHCKQLEPVYNSLAKKYKGQKGLVIAKMDATANDVPSDRYKVEGF
PTIYFAPSGDKKNPVKFEGGDRDLEHLSKFIEEHATKLSRTKEEL
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgaggccccggaaagccttcctgctcctgctgctcttggggctggtgcagctgctggcc
gtggcgggtgccgagggcccggacgaggattcttctaacagagaaaatgccattgaggat
gaagaggaggaggaggaggaagatgatgatgaggaagaagacgacttggaagttaaggaa
gaaaatggagtcttggtcctaaatgatgcaaactttgataattttgtggctgacaaagac
acagtgctgctggagttttatgctccatggtgtggacattgcaagcagtttgctccggaa
tatgaaaaaattgccaacatattaaaggataaagatcctcccattcctgttgccaagatc
gatgcaacctcagcgtctgtgctggccagcaggtttgatgtgagtggctaccccaccatc
aagatccttaagaaggggcaggctgtagactacgagggctccagaacccaggaagaaatt
gttgccaaggtcagagaagtctcccagcccgactggacgcctccaccagaagtcacgctt
gtgttgaccaaagagaactttgatgaagttgtgaatgatgcagatatcattctggtggag
ttttatgccccatggtgtggacactgcaagaaacttgcccccgagtatgagaaggccgcc
aaggagctcagcaagcgttctcctccaattcccctggcaaaggtcgacgccaccgcagaa
acagacctggccaagaggtttgatgtctctggctatcccaccctgaaaattttccgcaaa
ggaaggccttatgactacaacggcccacgagaaaaatatggaatcgttgattacatgatc
gagcagtccgggcctccctccaaggagattctgaccctgaagcaggtccaggagttcctg
aaggatggagacgatgtcatcatcatcggggtctttaagggggagagtgacccagcctac
cagcaataccaggatgccgctaacaacctgagagaagattacaaatttcaccacactttc
agcacagaaatagcaaagttcttgaaagtctcccaggggcagttggttgtaatgcagcct
gagaaattccagtccaagtatgagccccggagccacatgatggacgtccagggctccacc
caggactcggccatcaaggacttcgtgctgaagtacgccctgcccctggttggccaccgc
aaggtgtcaaacgatgctaagcgctacaccaggcgccccctggtggtcgtctactacagt
gtggacttcagctttgattacagagctgcaactcagttttggcggagcaaagtcctagag
gtggccaaggacttccctgagtacacctttgccattgcggacgaagaggactatgctggg
gaggtgaaggacctggggctcagcgagagtggggaggatgtcaatgccgccatcctggac
gagagtgggaagaagttcgccatggagccagaggagtttgactctgacaccctccgcgag
tttgtcactgctttcaaaaaaggaaaactgaagccagtcatcaaatcccagccagtgccc
aagaacaacaagggacccgtcaaggtcgtggtgggaaagacctttgactccattgtgatg
gaccccaagaaggacgtcctcatcgagttctacgcgccatggtgcgggcactgcaagcag
ctagagcccgtgtacaacagcctggccaagaagtacaagggccaaaagggcctggtcatc
gccaagatggacgccactgccaacgacgtccccagcgaccgctataaggtggagggcttc
cccaccatctacttcgcccccagtggggacaaaaagaacccagttaaatttgagggtgga
gacagagatctggagcatttgagcaagtttatagaagaacatgccacaaaactgagcagg
accaaggaagagctttga

DBGET integrated database retrieval system