KEGG   Homo sapiens (human): 9601Help
Entry
9601              CDS       T01001                                 

Gene name
PDIA4, ERP70, ERP72, ERp-72
Definition
protein disulfide isomerase family A, member 4 (EC:5.3.4.1)
Orthology
K09582  
protein disulfide-isomerase A4 [EC:5.3.4.1]
Organism
hsa  Homo sapiens (human)
Pathway
Protein processing in endoplasmic reticulum
Thyroid hormone synthesis
Vibrio cholerae infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    9601 (PDIA4)
 Organismal Systems
  Endocrine system
   04918 Thyroid hormone synthesis
    9601 (PDIA4)
 Human Diseases
  Infectious diseases
   05110 Vibrio cholerae infection
    9601 (PDIA4)
Enzymes [BR:hsa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     9601 (PDIA4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
7q35
AA seq 645 aa AA seqDB search
MRPRKAFLLLLLLGLVQLLAVAGAEGPDEDSSNRENAIEDEEEEEEEDDDEEEDDLEVKE
ENGVLVLNDANFDNFVADKDTVLLEFYAPWCGHCKQFAPEYEKIANILKDKDPPIPVAKI
DATSASVLASRFDVSGYPTIKILKKGQAVDYEGSRTQEEIVAKVREVSQPDWTPPPEVTL
VLTKENFDEVVNDADIILVEFYAPWCGHCKKLAPEYEKAAKELSKRSPPIPLAKVDATAE
TDLAKRFDVSGYPTLKIFRKGRPYDYNGPREKYGIVDYMIEQSGPPSKEILTLKQVQEFL
KDGDDVIIIGVFKGESDPAYQQYQDAANNLREDYKFHHTFSTEIAKFLKVSQGQLVVMQP
EKFQSKYEPRSHMMDVQGSTQDSAIKDFVLKYALPLVGHRKVSNDAKRYTRRPLVVVYYS
VDFSFDYRAATQFWRSKVLEVAKDFPEYTFAIADEEDYAGEVKDLGLSESGEDVNAAILD
ESGKKFAMEPEEFDSDTLREFVTAFKKGKLKPVIKSQPVPKNNKGPVKVVVGKTFDSIVM
DPKKDVLIEFYAPWCGHCKQLEPVYNSLAKKYKGQKGLVIAKMDATANDVPSDRYKVEGF
PTIYFAPSGDKKNPVKFEGGDRDLEHLSKFIEEHATKLSRTKEEL
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgaggccccggaaagccttcctgctcctgctgctcttggggctggtgcagctgctggcc
gtggcgggtgccgagggcccggacgaggattcttctaacagagaaaatgccattgaggat
gaagaggaggaggaggaggaagatgatgatgaggaagaagacgacttggaagttaaggaa
gaaaatggagtcttggtcctaaatgatgcaaactttgataattttgtggctgacaaagac
acagtgctgctggagttttatgctccatggtgtggacattgcaagcagtttgctccggaa
tatgaaaaaattgccaacatattaaaggataaagatcctcccattcctgttgccaagatc
gatgcaacctcagcgtctgtgctggccagcaggtttgatgtgagtggctaccccaccatc
aagatccttaagaaggggcaggctgtagactacgagggctccagaacccaggaagaaatt
gttgccaaggtcagagaagtctcccagcccgactggacgcctccaccagaagtcacgctt
gtgttgaccaaagagaactttgatgaagttgtgaatgatgcagatatcattctggtggag
ttttatgccccatggtgtggacactgcaagaaacttgcccccgagtatgagaaggccgcc
aaggagctcagcaagcgttctcctccaattcccctggcaaaggtcgacgccaccgcagaa
acagacctggccaagaggtttgatgtctctggctatcccaccctgaaaattttccgcaaa
ggaaggccttatgactacaacggcccacgagaaaaatatggaatcgttgattacatgatc
gagcagtccgggcctccctccaaggagattctgaccctgaagcaggtccaggagttcctg
aaggatggagacgatgtcatcatcatcggggtctttaagggggagagtgacccagcctac
cagcaataccaggatgccgctaacaacctgagagaagattacaaatttcaccacactttc
agcacagaaatagcaaagttcttgaaagtctcccaggggcagttggttgtaatgcagcct
gagaaattccagtccaagtatgagccccggagccacatgatggacgtccagggctccacc
caggactcggccatcaaggacttcgtgctgaagtacgccctgcccctggttggccaccgc
aaggtgtcaaacgatgctaagcgctacaccaggcgccccctggtggtcgtctactacagt
gtggacttcagctttgattacagagctgcaactcagttttggcggagcaaagtcctagag
gtggccaaggacttccctgagtacacctttgccattgcggacgaagaggactatgctggg
gaggtgaaggacctggggctcagcgagagtggggaggatgtcaatgccgccatcctggac
gagagtgggaagaagttcgccatggagccagaggagtttgactctgacaccctccgcgag
tttgtcactgctttcaaaaaaggaaaactgaagccagtcatcaaatcccagccagtgccc
aagaacaacaagggacccgtcaaggtcgtggtgggaaagacctttgactccattgtgatg
gaccccaagaaggacgtcctcatcgagttctacgcgccatggtgcgggcactgcaagcag
ctagagcccgtgtacaacagcctggccaagaagtacaagggccaaaagggcctggtcatc
gccaagatggacgccactgccaacgacgtccccagcgaccgctataaggtggagggcttc
cccaccatctacttcgcccccagtggggacaaaaagaacccagttaaatttgagggtgga
gacagagatctggagcatttgagcaagtttatagaagaacatgccacaaaactgagcagg
accaaggaagagctttga

DBGET integrated database retrieval system