KEGG   Homo sapiens (human): 9631Help
Entry
9631              CDS       T01001                                 

Gene name
NUP155, ATFB15, N155
Definition
(RefSeq) nucleoporin 155kDa
  KO
K14312  
nuclear pore complex protein Nup155
Organism
hsa  Homo sapiens (human)
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    9631 (NUP155)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     9631 (NUP155)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
5p13.1
AA seq 1391 aa AA seqDB search
MPSSLLGAAMPASTSAAALQEALENAGRLIDRQLQEDRMYPDLSELLMVSAPNNPTVSGM
SDMDYPLQGPGLLSVPNLPEISSIRRVPLPPELVEQFGHMQCNCMMGVFPPISRAWLTID
SDIFMWNYEDGGDLAYFDGLSETILAVGLVKPKAGIFQPHVRHLLVLATPVDIVILGLSY
ANLQTGSGVLNDSLSGGMQLLPDPLYSLPTDNTYLLTITSTDNGRIFLAGKDGCLYEVAY
QAEAGWFSQRCRKINHSKSSLSFLVPSLLQFTFSEDDPILQIAIDNSRNILYTRSEKGVI
QVYDLGQDGQGMSRVASVSQNAIVSAAGNIARTIDRSVFKPIVQIAVIENSESLDCQLLA
VTHAGVRLYFSTCPFRQPLARPNTLTLVHVRLPPGFSASSTVEKPSKVHRALYSKGILLM
AASENEDNDILWCVNHDTFPFQKPMMETQMTAGVDGHSWALSAIDELKVDKIITPLNKDH
IPITDSPVVVQQHMLPPKKFVLLSAQGSLMFHKLRPVDQLRHLLVSNVGGDGEEIERFFK
LHQEDQACATCLILACSTAACDREVSAWATRAFFRYGGEAQMRFPTTLPPPSNVGPILGS
PVYSSSPVPSGSPYPNPSFLGTPSHGIQPPAMSTPVCALGNPATQATNMSCVTGPEIVYS
GKHNGICIYFSRIMGNIWDASLVVERIFKSGNREITAIESSVPCQLLESVLQELKGLQEF
LDRNSQFAGGPLGNPNTTAKVQQRLIGFMRPENGNPQQMQQELQRKFHEAQLSEKISLQA
IQQLVRKSYQALALWKLLCEHQFTIIVAELQKELQEQLKITTFKDLVIRDKELTGALIAS
LINCYIRDNAAVDGISLHLQDICPLLYSTDDAICSKANELLQRSRQVQNKTEKERMLRES
LKEYQKISNQVDLSNVCAQYRQVRFYEGVVELSLTAAEKKDPQGLGLHFYKHGEPEEDIV
GLQAFQERLNSYKCITDTLQELVNQSKAAPQSPSVPKKPGPPVLSSDPNMLSNEEAGHHF
EQMLKLSQRSKDELFSIALYNWLIQVDLADKLLQVASPFLEPHLVRMAKVDQNRVRYMDL
LWRYYEKNRSFSNAARVLSRLADMHSTEISLQQRLEYIARAILSAKSSTAISSIAADGEF
LHELEEKMEVARIQLQIQETLQRQYSHHSSVQDAVSQLDSELMDITKLYGEFADPFKLAE
CKLAIIHCAGYSDPILVQTLWQDIIEKELSDSVTLSSSDRMHALSLKIVLLGKIYAGTPR
FFPLDFIVQFLEQQVCTLNWDVGFVIQTMNEIGVPLPRLLEVYDQLFKSRDPFWNRMKKP
LHLLDCIHVLLIRYVENPSQVLNCERRRFTNLCLDAVCGYLVELQSMSSSVAVQAITGNF
KSLQAKLERLH
NT seq 4176 nt NT seq  +upstreamnt  +downstreamnt
atgccgtcttctttgttgggcgcggcgatgccggcctctacatctgccgcagccctgcag
gaagctctggaaaatgctggacggctcatcgaccgtcagttgcaagaggaccgcatgtac
ccggacctttccgagctgcttatggtgtctgccccaaataatcccaccgtttctggcatg
tcagatatggattatcctttgcaaggacctggtttgctgtccgtacccaaccttccagag
atcagttccatccgaagagttcctctcccacctgaacttgttgagcagtttggacatatg
cagtgtaattgcatgatgggtgtgttccctcctatcagcagagcttggctcacaattgac
agtgatatattcatgtggaactatgaggatggaggagaccttgcctattttgatggactt
agtgagactattcttgctgtggggcttgtgaagccaaaagcaggcatctttcaacctcat
gtgcgacacctcctggttttggcgacccctgtagacatagtaattcttggactcagctat
gctaatttgcaaacaggttctggagttcttaatgatagtttgtctggtggaatgcagttg
cttccagatcctttatattctcttcctactgataatacttaccttttaacaataacttcc
actgataatggcagaattttcttggctggaaaggatggctgtttatatgaagtagcctac
caggctgaagcagggtggtttagccaaagatgtaggaaaataaaccactcaaagagctca
ctttctttccttgttccttccttgctacaattcacgttctcagaagatgatcctattctt
caaattgcaattgataattctagaaatattttatatacacgatctgagaaaggagtaata
caggtgtatgatttgggacaagatggacaaggaatgagcagagttgcctctgtgtcacag
aatgccattgtctctgctgctggtaacattgctaggaccatcgatcgttctgtttttaaa
ccaattgtccaaatagcagtgattgaaaattctgaatcactggactgtcagttattggct
gtcacacatgcaggtgttaggttatattttagcacttgtccattcagacagccattagca
cggcctaatacactgacgctggttcatgtccgcttacctcctggattctcagcatcttca
accgtggaaaagccttcaaaagtacatagagctctttatagtaaaggtattctattgatg
gcagcctcagaaaatgaggataatgatattttatggtgtgtcaaccatgatacttttcct
ttccaaaagccaatgatggaaacccagatgacagctggtgttgatggtcattcctgggct
ctttctgcgatagatgaattgaaagtagataaaataattacacctttaaacaaggatcat
attccaataactgattcaccagttgttgtacagcagcacatgttacctccgaagaaattt
gttctcctctcagcacaggggagccttatgtttcataaacttagacctgtagatcaactg
aggcatctacttgtgagtaatgtgggaggagatggagaagagattgaaagattctttaaa
ttacatcaggaagaccaggcttgtgcaacttgccttattcttgcttgctccactgctgcc
tgtgatagagaagtatctgcctgggctactcgggctttctttaggtatggtggtgaagca
cagatgagatttccaaccactcttccgcctccaagtaatgttggtcccatcttggggtct
cctgtctattctagttctcctgttcctagtggtagtccctatccaaatccatcctttttg
ggaacaccgtctcatggtatacagcctcctgccatgtcaactccagtgtgtgctctggga
aacccagcaactcaggccacaaatatgagttgtgtgactggaccagagattgtgtactct
ggaaaacacaatggtatttgcatttacttttctcggatcatgggaaacatttgggatgca
agcttagttgtggagagaatattcaagagtggcaacagagagatcactgcaattgaaagt
agtgttccctgccaactgctagagtcagtgctacaagaactaaagggtttgcaggaattt
ctagacagaaactcccagtttgcaggaggaccattaggaaatccaaatactactgctaaa
gtgcagcagaggctgataggattcatgcgtcctgaaaacggaaatccccagcaaatgcaa
caggaactgcagaggaagtttcatgaggctcaactaagtgaaaagatttcacttcaggca
attcagcagttggttcgaaaatcatatcaggctctggctttatggaaacttctttgtgaa
catcaattcactatcattgtggcagaacttcagaaggaacttcaagagcagctgaagatc
accacctttaaagatcttgtaatcagggacaaagaactcacaggggcattaattgcttct
cttatcaactgctacatcagagataatgccgctgttgatggcattagtttacatttacag
gatatctgcccacttctatatagcactgatgatgcaatttgttctaaggcaaatgagctt
ctccagcgttcccgacaagttcaaaataagactgaaaaagaaagaatgttaagggaatca
ttaaaggaatatcaaaaaattagcaatcaagtggacctttccaatgtttgtgctcagtat
agacaagtgagattttatgagggtgtggtggaactttctcttacggctgcagagaaaaaa
gatcctcaaggtcttgggcttcatttctataaacatggagaaccagaagaagacatagtt
ggacttcaggccttccaagaaagattaaacagttacaaatgcattacagacacacttcaa
gaactggtaaatcaaagtaaggccgctcctcagtctcccagtgtacccaaaaaacctggt
cctccagtgttgtcatctgatccaaatatgctgagtaatgaagaagcaggacatcatttt
gaacaaatgcttaaattgtcacagcgatccaaggatgagctctttagtattgccctttat
aattggctaatacaagtcgaccttgcagataagctgctacaggttgcttctccatttctg
gagccacatctagtccgaatggccaaagttgatcaaaacagagttcgttatatggattta
ctctggcggtattacgagaagaacagaagtttcagtaatgctgctcgtgtactgtccaga
ctggctgacatgcatagcacagaaatttcacttcagcagcgactagagtacattgctcga
gccattcttagtgccaaaagttccactgccatttcatcaatagctgccgatggtgaattt
cttcatgaattagaagaaaaaatggaggttgctaggatccaacttcagatacaggagaca
ctacaaaggcagtattcccatcattcttctgtacaggatgcagtttctcagctggattct
gagctgatggacataactaagctttatggggaatttgctgacccatttaaacttgcagag
tgcaaacttgcaataattcattgtgccggttattcagaccctatattggtgcagacactt
tggcaagatatcatagagaaagaattgagtgacagtgtgacattgagctcctcggataga
atgcatgctcttagtctcaagattgttctccttggcaaaatttatgctggcacaccacgc
ttctttcctttagattttattgtacagtttttagaacagcaggtttgtactttgaactgg
gatgtgggcttcgtaatacagacaatgaatgaaattggagtaccattacctagactacta
gaagtttatgatcagttgttcaaatcacgggatccattctggaacagaatgaagaagcca
ctgcaccttttggattgtatacatgtattattgataagatatgttgagaatcccagccaa
gttttaaattgtgaaaggagaagatttacaaatctctgcctggatgctgtttgtggttac
cttgttgagctccagtctatgagctcgtcagtagcagtacaagccatcactgggaatttt
aaatctcttcaagctaaattagaacggcttcattaa

DBGET integrated database retrieval system