KEGG   Homo sapiens (human): 9631Help
Entry
9631              CDS       T01001                                 

Gene name
NUP155, N155
Definition
nucleoporin 155kDa
Orthology
K14312  
nuclear pore complex protein Nup155
Organism
hsa  Homo sapiens (human)
Pathway
RNA transport
Module
Nuclear pore complex
Class
Genetic Information Processing; Translation; RNA transport [PATH:hsa03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
5p13.1
AA seq 1327 aa AA seqDB search
MPSSLLGAAMPASTSAAALQEALENAGRLIDRQLQEDRMYPDLSELLMVSAPNNPTVSGM
SDMDYPLQGPGLLSVPNLPEISSIRRVPLPPELVEQFGHMQCNCMMGVFPPISRAWLTID
SDIFMWNYEDGGDLAYFDGLSETILAVGLVKPKAGIFQPHVRHLLVLATPVDIVILGLSY
ANLQTGSGVLNDSLSGGMQLLPDPLYSLPTDNTYLLTITSTDNGRIFLAGKDGCLYEVAY
QAEAGWFSQRCRKINHSKSSLSFLVPSLLQFTFSEDDPILQIAIDNSRNILYTRSEKGVI
QVYDLGQDGQGMSRVASVSQNAIVSAAGNIARTIDRSVFKPIVQIAVIENSESLDCQLLA
VTHAGVRLYFSTCPFRQPLARPNTLTLVHVRLPPGFSASSTVEKPSKVHRALYSKGILLM
AASENEDNDILWCVNHDTFPFQKPMMETQMTAGVDGHSWALSAIDELKVDKIITPLNKDH
IPITDSPVVVQQHMLPPKKFVLLSAQGSLMFHKLRPVDQLRHLLVSNVGGDGEEIERFFK
LHQEDQACATCLILACSTAACDREVSAWATRAFFRYGGEAQMRFPTTLPPPSNVGPILGS
PVYSSSPVPSGSPYPNPSFLGTPSHGIQPPAMSTPVCALGNPATQATNMSCVTGPEIVYS
GKHNGICIYFSRIMGNIWDASLVVERIFKSGNREITAIESSVPCQLLESVLQELKGLQEF
LDRNSQFAGGPLGNPNTTAKVQQRLIGFMRPENGNPQQMQQELQRKFHEAQLSEKISLQA
IQQLVRKSYQALALWKLLCEHQFTIIVAELQKANELLQRSRQVQNKTEKERMLRESLKEY
QKISNQVDLSNVCAQYRQVRFYEGVVELSLTAAEKKDPQGLGLHFYKHGEPEEDIVGLQA
FQERLNSYKCITDTLQELVNQSKAAPQSPSVPKKPGPPVLSSDPNMLSNEEAGHHFEQML
KLSQRSKDELFSIALYNWLIQVDLADKLLQVASPFLEPHLVRMAKVDQNRVRYMDLLWRY
YEKNRSFSNAARVLSRLADMHSTEISLQQRLEYIARAILSAKSSTAISSIAADGEFLHEL
EEKMEVARIQLQIQETLQRQYSHHSSVQDAVSQLDSELMDITKLYGEFADPFKLAECKLA
IIHCAGYSDPILVQTLWQDIIEKELSDSVTLSSSDRMHALSLKIVLLGKIYAGTPRFFPL
DFIVQFLEQQVCTLNWDVGFVIQTMNEIGVPLPRLLEVYDQLFKSRDPFWNRMKKPLHLL
DCIHVLLIRYVENPSQVLNCERRRFTNLCLDAVCGYLVELQSMSSSVAVQAITGNFKSLQ
AKLERLH
NT seq 3984 nt NT seq  +upstreamnt  +downstreamnt
atgccgtcttctttgttgggcgcggcgatgccggcctctacatctgccgcagccctgcag
gaagctctggaaaatgctggacggctcatcgaccgtcagttgcaagaggaccgcatgtac
ccggacctttccgagctgcttatggtgtctgccccaaataatcccaccgtttctggcatg
tcagatatggattatcctttgcaaggacctggtttgctgtccgtacccaaccttccagag
atcagttccatccgaagagttcctctcccacctgaacttgttgagcagtttggacatatg
cagtgtaattgcatgatgggtgtgttccctcctatcagcagagcttggctcacaattgac
agtgatatattcatgtggaactatgaggatggaggagaccttgcctattttgatggactt
agtgagactattcttgctgtggggcttgtgaagccaaaagcaggcatctttcaacctcat
gtgcgacacctcctggttttggcgacccctgtagacatagtaattcttggactcagctat
gctaatttgcaaacaggttctggagttcttaatgatagtttgtctggtggaatgcagttg
cttccagatcctttatattctcttcctactgataatacttaccttttaacaataacttcc
actgataatggcagaattttcttggctggaaaggatggctgtttatatgaagtagcctac
caggctgaagcagggtggtttagccaaagatgtaggaaaataaaccactcaaagagctca
ctttctttccttgttccttccttgctacaattcacgttctcagaagatgatcctattctt
caaattgcaattgataattctagaaatattttatatacacgatctgagaaaggagtaata
caggtgtatgatttgggacaagatggacaaggaatgagcagagttgcctctgtgtcacag
aatgccattgtctctgctgctggtaacattgctaggaccatcgatcgttctgtttttaaa
ccaattgtccaaatagcagtgattgaaaattctgaatcactggactgtcagttattggct
gtcacacatgcaggtgttaggttatattttagcacttgtccattcagacagccattagca
cggcctaatacactgacgctggttcatgtccgcttacctcctggattctcagcatcttca
accgtggaaaagccttcaaaagtacatagagctctttatagtaaaggtattctattgatg
gcagcctcagaaaatgaggataatgatattttatggtgtgtcaaccatgatacttttcct
ttccaaaagccaatgatggaaacccagatgacagctggtgttgatggtcattcctgggct
ctttctgcgatagatgaattgaaagtagataaaataattacacctttaaacaaggatcat
attccaataactgattcaccagttgttgtacagcagcacatgttacctccgaagaaattt
gttctcctctcagcacaggggagccttatgtttcataaacttagacctgtagatcaactg
aggcatctacttgtgagtaatgtgggaggagatggagaagagattgaaagattctttaaa
ttacatcaggaagaccaggcttgtgcaacttgccttattcttgcttgctccactgctgcc
tgtgatagagaagtatctgcctgggctactcgggctttctttaggtatggtggtgaagca
cagatgagatttccaaccactcttccgcctccaagtaatgttggtcccatcttggggtct
cctgtctattctagttctcctgttcctagtggtagtccctatccaaatccatcctttttg
ggaacaccgtctcatggtatacagcctcctgccatgtcaactccagtgtgtgctctggga
aacccagcaactcaggccacaaatatgagttgtgtgactggaccagagattgtgtactct
ggaaaacacaatggtatttgcatttacttttctcggatcatgggaaacatttgggatgca
agcttagttgtggagagaatattcaagagtggcaacagagagatcactgcaattgaaagt
agtgttccctgccaactgctagagtcagtgctacaagaactaaagggtttgcaggaattt
ctagacagaaactcccagtttgcaggaggaccattaggaaatccaaatactactgctaaa
gtgcagcagaggctgataggattcatgcgtcctgaaaacggaaatccccagcaaatgcaa
caggaactgcagaggaagtttcatgaggctcaactaagtgaaaagatttcacttcaggca
attcagcagttggttcgaaaatcatatcaggctctggctttatggaaacttctttgtgaa
catcaattcactatcattgtggcagaacttcagaaggcaaatgagcttctccagcgttcc
cgacaagttcaaaataagactgaaaaagaaagaatgttaagggaatcattaaaggaatat
caaaaaattagcaatcaagtggacctttccaatgtttgtgctcagtatagacaagtgaga
ttttatgagggtgtggtggaactttctcttacggctgcagagaaaaaagatcctcaaggt
cttgggcttcatttctataaacatggagaaccagaagaagacatagttggacttcaggcc
ttccaagaaagattaaacagttacaaatgcattacagacacacttcaagaactggtaaat
caaagtaaggccgctcctcagtctcccagtgtacccaaaaaacctggtcctccagtgttg
tcatctgatccaaatatgctgagtaatgaagaagcaggacatcattttgaacaaatgctt
aaattgtcacagcgatccaaggatgagctctttagtattgccctttataattggctaata
caagtcgaccttgcagataagctgctacaggttgcttctccatttctggagccacatcta
gtccgaatggccaaagttgatcaaaacagagttcgttatatggatttactctggcggtat
tacgagaagaacagaagtttcagtaatgctgctcgtgtactgtccagactggctgacatg
catagcacagaaatttcacttcagcagcgactagagtacattgctcgagccattcttagt
gccaaaagttccactgccatttcatcaatagctgccgatggtgaatttcttcatgaatta
gaagaaaaaatggaggttgctaggatccaacttcagatacaggagacactacaaaggcag
tattcccatcattcttctgtacaggatgcagtttctcagctggattctgagctgatggac
ataactaagctttatggggaatttgctgacccatttaaacttgcagagtgcaaacttgca
ataattcattgtgccggttattcagaccctatattggtgcagacactttggcaagatatc
atagagaaagaattgagtgacagtgtgacattgagctcctcggatagaatgcatgctctt
agtctcaagattgttctccttggcaaaatttatgctggcacaccacgcttctttccttta
gattttattgtacagtttttagaacagcaggtttgtactttgaactgggatgtgggcttc
gtaatacagacaatgaatgaaattggagtaccattacctagactactagaagtttatgat
cagttgttcaaatcacgggatccattctggaacagaatgaagaagccactgcaccttttg
gattgtatacatgtattattgataagatatgttgagaatcccagccaagttttaaattgt
gaaaggagaagatttacaaatctctgcctggatgctgtttgtggttaccttgttgagctc
cagtctatgagctcgtcagtagcagtacaagccatcactgggaattttaaatctcttcaa
gctaaattagaacggcttcattaa

DBGET integrated database retrieval system