KEGG   Homo sapiens (human): 9635Help
Entry
9635              CDS       T01001                                 

Gene name
CLCA2, CACC, CACC3, CLCRG2, CaCC-3
Definition
chloride channel accessory 2
Orthology
K05028  
calcium-activated chloride channel regulator 2
Organism
hsa  Homo sapiens (human)
Pathway
Olfactory transduction
Pancreatic secretion
Drug target
Niflumic acid: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04972 Pancreatic secretion
    9635 (CLCA2)
  Sensory system
   04740 Olfactory transduction
    9635 (CLCA2)
Ion channels [BR:hsa04040]
 Chloride channels
  Calcium activated chloride channel
   9635 (CLCA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p22.3
AA seq 943 aa AA seqDB search
MTQRSIAGPICNLKFVTLLVALSSELPFLGAGVQLQDNGYNGLLIAINPQVPENQNLISN
IKEMITEASFYLFNATKRRVFFRNIKILIPATWKANNNSKIKQESYEKANVIVTDWYGAH
GDDPYTLQYRGCGKEGKYIHFTPNFLLNDNLTAGYGSRGRVFVHEWAHLRWGVFDEYNND
KPFYINGQNQIKVTRCSSDITGIFVCEKGPCPQENCIISKLFKEGCTFIYNSTQNATASI
MFMQSLSSVVEFCNASTHNQEAPNLQNQMCSLRSAWDVITDSADFHHSFPMNGTELPPPP
TFSLVQAGDKVVCLVLDVSSKMAEADRLLQLQQAAEFYLMQIVEIHTFVGIASFDSKGEI
RAQLHQINSNDDRKLLVSYLPTTVSAKTDISICSGLKKGFEVVEKLNGKAYGSVMILVTS
GDDKLLGNCLPTVLSSGSTIHSIALGSSAAPNLEELSRLTGGLKFFVPDISNSNSMIDAF
SRISSGTGDIFQQHIQLESTGENVKPHHQLKNTVTVDNTVGNDTMFLVTWQASGPPEIIL
FDPDGRKYYTNNFITNLTFRTASLWIPGTAKPGHWTYTLNNTHHSLQALKVTVTSRASNS
AVPPATVEAFVERDSLHFPHPVMIYANVKQGFYPILNATVTATVEPETGDPVTLRLLDDG
AGADVIKNDGIYSRYFFSFAANGRYSLKVHVNHSPSISTPAHSIPGSHAMYVPGYTANGN
IQMNAPRKSVGRNEEERKWGFSRVSSGGSFSVLGVPAGPHPDVFPPCKIIDLEAVKVEEE
LTLSWTAPGEDFDQGQATSYEIRMSKSLQNIQDDFNNAILVNTSKRNPQQAGIREIFTFS
PQISTNGPEHQPNGETHESHRIYVAIRAMDRNSLQSAVSNIAQAPLFIPPNSDPVPARDY
LILKGVLTAMGLIGIICLIIVVTHHTLSRKKRADKKENGTKLL
NT seq 2832 nt NT seq  +upstreamnt  +downstreamnt
atgacccaaaggagcattgcaggtcctatttgcaacctgaagtttgtgactctcctggtt
gccttaagttcagaactcccattcctgggagctggagtacagcttcaagacaatgggtat
aatggattgctcattgcaattaatcctcaggtacctgagaatcagaacctcatctcaaac
attaaggaaatgataactgaagcttcattttacctatttaatgctaccaagagaagagta
tttttcagaaatataaagattttaatacctgccacatggaaagctaataataacagcaaa
ataaaacaagaatcatatgaaaaggcaaatgtcatagtgactgactggtatggggcacat
ggagatgatccatacaccctacaatacagagggtgtggaaaagagggaaaatacattcat
ttcacacctaatttcctactgaatgataacttaacagctggctacggatcacgaggccga
gtgtttgtccatgaatgggcccacctccgttggggtgtgttcgatgagtataacaatgac
aaacctttctacataaatgggcaaaatcaaattaaagtgacaaggtgttcatctgacatc
acaggcatttttgtgtgtgaaaaaggtccttgcccccaagaaaactgtattattagtaag
ctttttaaagaaggatgcacctttatctacaatagcacccaaaatgcaactgcatcaata
atgttcatgcaaagtttatcttctgtggttgaattttgtaatgcaagtacccacaaccaa
gaagcaccaaacctacagaaccagatgtgcagcctcagaagtgcatgggatgtaatcaca
gactctgctgactttcaccacagctttcccatgaatgggactgagcttccacctcctccc
acattctcgcttgtacaggctggtgacaaagtggtctgtttagtgctggatgtgtccagc
aagatggcagaggctgacagactccttcaactacaacaagccgcagaattttatttgatg
cagattgttgaaattcataccttcgtgggcattgccagtttcgacagcaaaggagagatc
agagcccagctacaccaaattaacagcaatgatgatcgaaagttgctggtttcatatctg
cccaccactgtatcagctaaaacagacatcagcatttgttcagggcttaagaaaggattt
gaggtggttgaaaaactgaatggaaaagcttatggctctgtgatgatattagtgaccagc
ggagatgataagcttcttggcaattgcttacccactgtgctcagcagtggttcaacaatt
cactccattgccctgggttcatctgcagccccaaatctggaggaattatcacgtcttaca
ggaggtttaaagttctttgttccagatatatcaaactccaatagcatgattgatgctttc
agtagaatttcctctggaactggagacattttccagcaacatattcagcttgaaagtaca
ggtgaaaatgtcaaacctcaccatcaattgaaaaacacagtgactgtggataatactgtg
ggcaacgacactatgtttctagttacgtggcaggccagtggtcctcctgagattatatta
tttgatcctgatggacgaaaatactacacaaataattttatcaccaatctaacttttcgg
acagctagtctttggattccaggaacagctaagcctgggcactggacttacaccctgaac
aatacccatcattctctgcaagccctgaaagtgacagtgacctctcgcgcctccaactca
gctgtgcccccagccactgtggaagcctttgtggaaagagacagcctccattttcctcat
cctgtgatgatttatgccaatgtgaaacagggattttatcccattcttaatgccactgtc
actgccacagttgagccagagactggagatcctgttacgctgagactccttgatgatgga
gcaggtgctgatgttataaaaaatgatggaatttactcgaggtattttttctcctttgct
gcaaatggtagatatagcttgaaagtgcatgtcaatcactctcccagcataagcacccca
gcccactctattccagggagtcatgctatgtatgtaccaggttacacagcaaacggtaat
attcagatgaatgctccaaggaaatcagtaggcagaaatgaggaggagcgaaagtggggc
tttagccgagtcagctcaggaggctccttttcagtgctgggagttccagctggcccccac
cctgatgtgtttccaccatgcaaaattattgacctggaagctgtaaaagtagaagaggaa
ttgaccctatcttggacagcacctggagaagactttgatcagggccaggctacaagctat
gaaataagaatgagtaaaagtctacagaatatccaagatgactttaacaatgctatttta
gtaaatacatcaaagcgaaatcctcagcaagctggcatcagggagatatttacgttctca
ccccaaatttccacgaatggacctgaacatcagccaaatggagaaacacatgaaagccac
agaatttatgttgcaatacgagcaatggataggaactccttacagtctgctgtatctaac
attgcccaggcgcctctgtttattccccccaattctgatcctgtacctgccagagattat
cttatattgaaaggagttttaacagcaatgggtttgataggaatcatttgccttattata
gttgtgacacatcatactttaagcaggaaaaagagagcagacaagaaagagaatggaaca
aaattattataa

DBGET integrated database retrieval system