KEGG   Homo sapiens (human): 9636Help
Entry
9636              CDS       T01001                                 

Gene name
ISG15, G1P2, IFI15, IP17, UCRP, hUCRP
Definition
ISG15 ubiquitin-like modifier
Orthology
K12159  
ubiquitin cross-reactive protein
Organism
hsa  Homo sapiens (human)
Pathway
RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04622 RIG-I-like receptor signaling pathway
    9636 (ISG15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p36.33
AA seq 165 aa AA seqDB search
MGWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPL
ASQGLGPGSTVLLVVDKCDEPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDD
LFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGGGTEPGGRS
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgggctgggacctgacggtgaagatgctggcgggcaacgaattccaggtgtccctgagc
agctccatgtcggtgtcagagctgaaggcgcagatcacccagaagatcggcgtgcacgcc
ttccagcagcgtctggctgtccacccgagcggtgtggcgctgcaggacagggtccccctt
gccagccagggcctgggccccggcagcacggtcctgctggtggtggacaaatgcgacgaa
cctctgagcatcctggtgaggaataacaagggccgcagcagcacctacgaggtacggctg
acgcagaccgtggcccacctgaagcagcaagtgagcgggctggagggtgtgcaggacgac
ctgttctggctgaccttcgaggggaagcccctggaggaccagctcccgctgggggagtac
ggcctcaagcccctgagcaccgtgttcatgaatctgcgcctgcggggaggcggcacagag
cctggcgggcggagctaa

DBGET integrated database retrieval system