KEGG   Homo sapiens (human): 9641Help
Entry
9641              CDS       T01001                                 

Gene name
IKBKE, IKK-E, IKK-i, IKKE, IKKI
Definition
(RefSeq) inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase epsilon (EC:2.7.11.10)
  KO
K07211  
inhibitor of nuclear factor kappa-B kinase subunit epsilon [EC:2.7.11.10]
Organism
hsa  Homo sapiens (human)
Pathway
Toll-like receptor signaling pathway
RIG-I-like receptor signaling pathway
Cytosolic DNA-sensing pathway
Hepatitis C
Hepatitis B
Measles
Influenza A
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    9641 (IKBKE)
   04622 RIG-I-like receptor signaling pathway
    9641 (IKBKE)
   04623 Cytosolic DNA-sensing pathway
    9641 (IKBKE)
 Human Diseases
  Infectious diseases
   05162 Measles
    9641 (IKBKE)
   05164 Influenza A
    9641 (IKBKE)
   05161 Hepatitis B
    9641 (IKBKE)
   05160 Hepatitis C
    9641 (IKBKE)
   05168 Herpes simplex infection
    9641 (IKBKE)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     9641 (IKBKE)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: Other group
  IKK family [OT]
   9641 (IKBKE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1q32.1
AA seq 716 aa AA seqDB search
MQSTANYLWHTDDLLGQGATASVYKARNKKSGELVAVKVFNTTSYLRPREVQVREFEVLR
KLNHQNIVKLFAVEETGGSRQKVLVMEYCSSGSLLSVLESPENAFGLPEDEFLVVLRCVV
AGMNHLRENGIVHRDIKPGNIMRLVGEEGQSIYKLTDFGAARELDDDEKFVSVYGTEEYL
HPDMYERAVLRKPQQKAFGVTVDLWSIGVTLYHAATGSLPFIPFGGPRRNKEIMYRITTE
KPAGAIAGAQRRENGPLEWSYTLPITCQLSLGLQSQLVPILANILEVEQAKCWGFDQFFA
ETSDILQRVVVHVFSLSQAVLHHIYIHAHNTIAIFQEAVHKQTSVAPRHQEYLFEGHLCV
LEPSVSAQHIAHTTASSPLTLFSTAIPKGLAFRDPALDVPKFVPKVDLQADYNTAKGVLG
AGYQALRLARALLDGQELMFRGLHWVMEVLQATCRRTLEVARTSLLYLSSSLGTERFSSV
AGTPEIQELKAAAELRSRLRTLAEVLSRCSQNITETQESLSSLNRELVKSRDQVHEDRSI
QQIQCCLDKMNFIYKQFKKSRMRPGLGYNEEQIHKLDKVNFSHLAKRLLQVFQEECVQKY
QASLVTHGKRMRVVHETRNHLRLVGCSVAACNTEAQGVQESLSKLLEELSHQLLQDRAKG
AQASPPPIAPYPSPTRKDLLLHMQELCEGMKLLASDLLDNNRIIERLNRVPAPPDV
NT seq 2151 nt NT seq  +upstreamnt  +downstreamnt
atgcagagcacagccaattacctgtggcacacagatgacctgctggggcagggggccact
gccagtgtgtacaaggcccgcaacaagaaatccggagagctggttgctgtgaaggtcttc
aacactaccagctacctgcggccccgcgaggtgcaggtgagggagtttgaggtcctgcgg
aagctgaaccaccagaacattgtcaagctctttgcggtggaggagacgggcggaagccgg
cagaaggtactggtgatggagtactgctccagtgggagcctgctgagtgtgctggagagc
cctgagaatgcctttgggctgcctgaggatgagttcctggtggtgctgcgctgtgtggtg
gccggcatgaaccacctgcgggagaacggcattgtgcatcgcgacatcaagccggggaac
atcatgcgcctcgtaggggaggaggggcagagcatctacaagctgacagacttcggcgct
gcccgggagctggatgatgatgagaagttcgtctcggtctatgggactgaggagtacctg
catcccgacatgtatgagcgggcggtgcttcgaaagccccagcaaaaagcgttcggggtg
actgtggatctctggagcattggagtgaccttgtaccatgcagccactggcagcctgccc
ttcatcccctttggtgggccacggcggaacaaggagatcatgtaccggatcaccacggag
aagccggctggggccattgcaggtgcccagaggcgggagaacgggcccctggagtggagc
tacaccctccccatcacctgccagctgtcactggggctgcagagccagctggtgcccatc
ctggccaacatcctggaggtggagcaggccaagtgctggggcttcgaccagttctttgcg
gagaccagtgacatcctgcagcgagttgtcgtccatgtcttctccctgtcccaggcagtc
ctgcaccacatctatatccatgcccacaacacgatagccattttccaggaggccgtgcac
aagcagaccagtgtggccccccgacaccaggagtacctctttgagggtcacctctgtgtc
ctcgagcccagcgtctcagcacagcacatcgcccacacgacggcaagcagccccctgacc
ctcttcagcacagccatccctaaggggctggccttcagggaccctgctctggacgtcccc
aagttcgtccccaaagtggacctgcaggcggattacaacactgccaagggcgtgttgggc
gccggctaccaggccctgcggctggcacgggccctgctggatgggcaggagctaatgttt
cgggggctgcactgggtcatggaggtgctccaggccacatgcagacggactctggaagtg
gcaaggacatccctcctctacctcagcagcagcctgggaactgagaggttcagcagcgtg
gctggaacgcctgagatccaggaactgaaggcggctgcagaactgaggtccaggctgcgg
actctagcggaggtcctctccagatgctcccaaaatatcacggagacccaggagagcctg
agcagcctgaaccgggagctggtgaagagccgggatcaggtacatgaggacagaagcatc
cagcagattcagtgctgtttggacaagatgaacttcatctacaaacagttcaagaagtct
aggatgaggccagggcttggctacaacgaggagcagattcacaagctggataaggtgaat
ttcagtcatttagccaaaagactcctgcaggtgttccaggaggagtgcgtgcagaagtat
caagcgtccttagtcacacacggcaagaggatgagggtggtgcacgagaccaggaaccac
ctgcgcctggttggctgttctgtggctgcctgtaacacagaagcccagggggtccaggag
agtctcagcaagctcctggaagagctatctcaccagctccttcaggaccgagcaaagggg
gctcaggcctcgccgcctcccatagctccttaccccagccctacacgaaaggacctgctt
ctccacatgcaagagctctgcgaggggatgaagctgctggcatctgacctcctggacaac
aaccgcatcatcgaacggctaaatagagtcccagcacctcctgatgtctga

DBGET integrated database retrieval system