KEGG   Homo sapiens (human): 9641Help
Entry
9641              CDS       T01001                                 

Gene name
IKBKE, IKK-E, IKK-i, IKKE, IKKI
Definition
inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase epsilon (EC:2.7.11.10)
Orthology
K07211  
inhibitor of nuclear factor kappa-B kinase subunit epsilon [EC:2.7.11.10]
Organism
hsa  Homo sapiens (human)
Pathway
Toll-like receptor signaling pathway
RIG-I-like receptor signaling pathway
Cytosolic DNA-sensing pathway
Hepatitis C
Hepatitis B
Measles
Influenza A
Herpes simplex infection
Class
Organismal Systems; Immune system; Toll-like receptor signaling pathway [PATH:hsa04620]
Organismal Systems; Immune system; RIG-I-like receptor signaling pathway [PATH:hsa04622]
Organismal Systems; Immune system; Cytosolic DNA-sensing pathway [PATH:hsa04623]
Human Diseases; Infectious diseases; Measles [PATH:hsa05162]
Human Diseases; Infectious diseases; Influenza A [PATH:hsa05164]
Human Diseases; Infectious diseases; Hepatitis B [PATH:hsa05161]
Human Diseases; Infectious diseases; Hepatitis C [PATH:hsa05160]
Human Diseases; Infectious diseases; Herpes simplex infection [PATH:hsa05168]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1q32.1
AA seq 631 aa AA seqDB search
MEYCSSGSLLSVLESPENAFGLPEDEFLVVLRCVVAGMNHLRENGIVHRDIKPGNIMRLV
GEEGQSIYKLTDFGAARELDDDEKFVSVYGTEEYLHPDMYERAVLRKPQQKAFGVTVDLW
SIGVTLYHAATGSLPFIPFGGPRRNKEIMYRITTEKPAGAIAGAQRRENGPLEWSYTLPI
TCQLSLGLQSQLVPILANILEVEQAKCWGFDQFFAETSDILQRVVVHVFSLSQAVLHHIY
IHAHNTIAIFQEAVHKQTSVAPRHQEYLFEGHLCVLEPSVSAQHIAHTTASSPLTLFSTA
IPKGLAFRDPALDVPKFVPKVDLQADYNTAKGVLGAGYQALRLARALLDGQELMFRGLHW
VMEVLQATCRRTLEVARTSLLYLSSSLGTERFSSVAGTPEIQELKAAAELRSRLRTLAEV
LSRCSQNITETQESLSSLNRELVKSRDQVHEDRSIQQIQCCLDKMNFIYKQFKKSRMRPG
LGYNEEQIHKLDKVNFSHLAKRLLQVFQEECVQKYQASLVTHGKRMRVVHETRNHLRLVG
CSVAACNTEAQGVQESLSKLLEELSHQLLQDRAKGAQASPPPIAPYPSPTRKDLLLHMQE
LCEGMKLLASDLLDNNRIIERLNRVPAPPDV
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atggagtactgctccagtgggagcctgctgagtgtgctggagagccctgagaatgccttt
gggctgcctgaggatgagttcctggtggtgctgcgctgtgtggtggccggcatgaaccac
ctgcgggagaacggcattgtgcatcgcgacatcaagccggggaacatcatgcgcctcgta
ggggaggaggggcagagcatctacaagctgacagacttcggcgctgcccgggagctggat
gatgatgagaagttcgtctcggtctatgggactgaggagtacctgcatcccgacatgtat
gagcgggcggtgcttcgaaagccccagcaaaaagcgttcggggtgactgtggatctctgg
agcattggagtgaccttgtaccatgcagccactggcagcctgcccttcatcccctttggt
gggccacggcggaacaaggagatcatgtaccggatcaccacggagaagccggctggggcc
attgcaggtgcccagaggcgggagaacgggcccctggagtggagctacaccctccccatc
acctgccagctgtcactggggctgcagagccagctggtgcccatcctggccaacatcctg
gaggtggagcaggccaagtgctggggcttcgaccagttctttgcggagaccagtgacatc
ctgcagcgagttgtcgtccatgtcttctccctgtcccaggcagtcctgcaccacatctat
atccatgcccacaacacgatagccattttccaggaggccgtgcacaagcagaccagtgtg
gccccccgacaccaggagtacctctttgagggtcacctctgtgtcctcgagcccagcgtc
tcagcacagcacatcgcccacacgacggcaagcagccccctgaccctcttcagcacagcc
atccctaaggggctggccttcagggaccctgctctggacgtccccaagttcgtccccaaa
gtggacctgcaggcggattacaacactgccaagggcgtgttgggcgccggctaccaggcc
ctgcggctggcacgggccctgctggatgggcaggagctaatgtttcgggggctgcactgg
gtcatggaggtgctccaggccacatgcagacggactctggaagtggcaaggacatccctc
ctctacctcagcagcagcctgggaactgagaggttcagcagcgtggctggaacgcctgag
atccaggaactgaaggcggctgcagaactgaggtccaggctgcggactctagcggaggtc
ctctccagatgctcccaaaatatcacggagacccaggagagcctgagcagcctgaaccgg
gagctggtgaagagccgggatcaggtacatgaggacagaagcatccagcagattcagtgc
tgtttggacaagatgaacttcatctacaaacagttcaagaagtctaggatgaggccaggg
cttggctacaacgaggagcagattcacaagctggataaggtgaatttcagtcatttagcc
aaaagactcctgcaggtgttccaggaggagtgcgtgcagaagtatcaagcgtccttagtc
acacacggcaagaggatgagggtggtgcacgagaccaggaaccacctgcgcctggttggc
tgttctgtggctgcctgtaacacagaagcccagggggtccaggagagtctcagcaagctc
ctggaagagctatctcaccagctccttcaggaccgagcaaagggggctcaggcctcgccg
cctcccatagctccttaccccagccctacacgaaaggacctgcttctccacatgcaagag
ctctgcgaggggatgaagctgctggcatctgacctcctggacaacaaccgcatcatcgaa
cggctaaatagagtcccagcacctcctgatgtctga

DBGET integrated database retrieval system