KEGG   Homo sapiens (human): 965Help
Entry
965               CDS       T01001                                 

Gene name
CD58, LFA-3, LFA3, ag3
Definition
(RefSeq) CD58 molecule
  KO
K06492  
CD58 antigen
Organism
hsa  Homo sapiens (human)
Pathway
Cell adhesion molecules (CAMs)
Epstein-Barr virus infection
Drug target
Alefacept: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    965 (CD58)
 Human Diseases
  Infectious diseases
   05169 Epstein-Barr virus infection
    965 (CD58)
Cell adhesion molecules and their ligands [BR:hsa04516]
 1. Immunoglobulin Superfamily
  Immune system
   CD2 family
    CD2; CD2 antigen [KO:K06449]
     965 (CD58)
Cellular antigens [BR:hsa04090]
 Proteins
  965 (CD58)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Others
  965 (CD58)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
P19256(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
1p13.1
AA seq 250 aa AA seqDB search
MVAGSDAGRALGVLSVVCLLHCFGFISCFSQQIYGVVYGNVTFHVPSNVPLKEVLWKKQK
DKVAELENSEFRAFSSFKNRVYLDTVSGSLTIYNLTSSDEDEYEMESPNITDTMKFFLYV
LESLPSPTLTCALTNGSIEVQCMIPEHYNSHRGLIMYSWDCPMEQCKRNSTSIYFKMEND
LPQKIQCTLSNPLFNTTSSIILTTCIPSSGHSRHRYALIPIPLAVITTCIVLYMNGILKC
DRKPDRTNSN
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggttgctgggagcgacgcggggcgggccctgggggtcctcagcgtggtctgcctgctg
cactgctttggtttcatcagctgtttttcccaacaaatatatggtgttgtgtatgggaat
gtaactttccatgtaccaagcaatgtgcctttaaaagaggtcctatggaaaaaacaaaag
gataaagttgcagaactggaaaattctgaattcagagctttctcatcttttaaaaatagg
gtttatttagacactgtgtcaggtagcctcactatctacaacttaacatcatcagatgaa
gatgagtatgaaatggaatcgccaaatattactgataccatgaagttctttctttatgtg
cttgagtctcttccatctcccacactaacttgtgcattgactaatggaagcattgaagtc
caatgcatgataccagagcattacaacagccatcgaggacttataatgtactcatgggat
tgtcctatggagcaatgtaaacgtaactcaaccagtatatattttaagatggaaaatgat
cttccacaaaaaatacagtgtactcttagcaatccattatttaatacaacatcatcaatc
attttgacaacctgtatcccaagcagcggtcattcaagacacagatatgcacttataccc
ataccattagcagtaattacaacatgtattgtgctgtatatgaatggtattctgaaatgt
gacagaaaaccagacagaaccaactccaattga

DBGET integrated database retrieval system