KEGG   Homo sapiens (human): 9653Help
Entry
9653              CDS       T01001                                 

Gene name
HS2ST1, dJ604K5.2
Definition
heparan sulfate 2-O-sulfotransferase 1 (EC:2.8.2.-)
Orthology
K02513  
heparan sulfate 2-O-sulfotransferase HS2ST1 [EC:2.8.2.-]
Organism
hsa  Homo sapiens (human)
Pathway
Glycosaminoglycan biosynthesis - heparan sulfate / heparin
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00534 Glycosaminoglycan biosynthesis - heparan sulfate / heparin
    9653 (HS2ST1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.2  Sulfotransferases
    2.8.2.-  
     9653 (HS2ST1)
Glycosyltransferases [BR:hsa01003]
 Unclassified
  Sulfotransferases
   9653 (HS2ST1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p22.3
AA seq 229 aa AA seqDB search
MGLLRIMMPPKLQLLAVVAFAVAMLFLENQIQKLEESRSKLERAIARHEVREIEQRHTMD
GPRQDATLDEEEDMVIIYNRVPKTASTSFTNIAYDLCAKNKYHVLHINTTKNNPVMSLQD
QVRFVKNITSWKEMKPGFYHGHVSYLDFAKFGVKKKPIYINVIRDPIERLVSYYYFLRFG
DDYRPGLRRRKQGDKKTFDECVAEGGSDCAPEKLWLQIPFFCGHSSECW
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atggggctcctcaggattatgatgccgcccaagttgcagctgctggcggtggtggccttc
gcggtggcgatgctcttcttggaaaaccagatccagaaactggaggagtcccgctcgaag
ctagaaagggctattgcaagacacgaagtccgagaaattgagcagcgacatacaatggat
ggccctcggcaagatgccactttagatgaggaagaggacatggtgatcatttataacaga
gttcccaaaacggcaagcacttcatttaccaatatcgcctatgacctgtgtgcaaagaat
aaataccatgtccttcatatcaacactaccaaaaataatccagtgatgtcattgcaagat
caggtgcgctttgtaaagaatataacttcctggaaagagatgaaaccaggattttatcat
ggacacgtttcttacttggattttgcaaaatttggtgtgaagaagaaaccaatttacatt
aatgtcataagggatcctattgagaggctagtttcttattattactttctgagatttgga
gatgattatagaccagggttacggagacgaaaacaaggagacaaaaagacctttgatgaa
tgtgtagcagaaggtggctcagactgtgctccagagaagctctggcttcaaatcccgttc
ttctgtggccatagctccgaatgctggtag

DBGET integrated database retrieval system