KEGG   Homo sapiens (human): 9653Help
Entry
9653              CDS       T01001                                 

Gene name
HS2ST1, dJ604K5.2
Definition
(RefSeq) heparan sulfate 2-O-sulfotransferase 1
  KO
K02513  heparan sulfate 2-O-sulfotransferase HS2ST1 [EC:2.8.2.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00534  Glycosaminoglycan biosynthesis - heparan sulfate / heparin
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00534 Glycosaminoglycan biosynthesis - heparan sulfate / heparin
    9653 (HS2ST1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.2  Sulfotransferases
    2.8.2.-  
     9653 (HS2ST1)
Glycosyltransferases [BR:hsa01003]
 Unclassified
  Sulfotransferases
   9653 (HS2ST1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sulfotransfer_2 Gal-3-0_sulfotr Sulfotransfer_1 RAP DICT
Motif
Other DBs
NCBI-GeneID: 9653
NCBI-ProteinID: NP_036394
OMIM: 604844
HGNC: 5193
Ensembl: ENSG00000153936
Vega: OTTHUMG00000010255
Pharos: Q7LGA3(Tdark)
UniProt: Q7LGA3
Position
1p22.3
AA seq 356 aa AA seqDB search
MGLLRIMMPPKLQLLAVVAFAVAMLFLENQIQKLEESRSKLERAIARHEVREIEQRHTMD
GPRQDATLDEEEDMVIIYNRVPKTASTSFTNIAYDLCAKNKYHVLHINTTKNNPVMSLQD
QVRFVKNITSWKEMKPGFYHGHVSYLDFAKFGVKKKPIYINVIRDPIERLVSYYYFLRFG
DDYRPGLRRRKQGDKKTFDECVAEGGSDCAPEKLWLQIPFFCGHSSECWNVGSRWAMDQA
KYNLINEYFLVGVTEELEDFIMLLEAALPRFFRGATELYRTGKKSHLRKTTEKKLPTKQT
IAKLQQSDIWKMENEFYEFALEQFQFIRAHAVREKDGDLYILAQNFFYEKIYPKSN
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atggggctcctcaggattatgatgccgcccaagttgcagctgctggcggtggtggccttc
gcggtggcgatgctcttcttggaaaaccagatccagaaactggaggagtcccgctcgaag
ctagaaagggctattgcaagacacgaagtccgagaaattgagcagcgacatacaatggat
ggccctcggcaagatgccactttagatgaggaagaggacatggtgatcatttataacaga
gttcccaaaacggcaagcacttcatttaccaatatcgcctatgacctgtgtgcaaagaat
aaataccatgtccttcatatcaacactaccaaaaataatccagtgatgtcattgcaagat
caggtgcgctttgtaaagaatataacttcctggaaagagatgaaaccaggattttatcat
ggacacgtttcttacttggattttgcaaaatttggtgtgaagaagaaaccaatttacatt
aatgtcataagggatcctattgagaggctagtttcttattattactttctgagatttgga
gatgattatagaccagggttacggagacgaaaacaaggagacaaaaagacctttgatgaa
tgtgtagcagaaggtggctcagactgtgctccagagaagctctggcttcaaatcccgttc
ttctgtggccatagctccgaatgctggaatgtgggaagcaggtgggctatggatcaagcc
aagtataacctaattaatgaatattttctggtgggagttactgaagaacttgaagatttt
atcatgttattggaggcagcattgccccggtttttcaggggtgctactgaactctatcgc
acaggaaagaaatctcatcttaggaaaaccacagagaagaaactccccactaaacaaacc
attgcaaaactacagcaatctgatatttggaaaatggagaatgagttctatgaatttgca
ctagagcagttccaattcatcagagcccatgccgttcgagaaaaagatggagacctctac
atcctcgcacaaaactttttctatgaaaagatttaccctaagtcgaactga

DBGET integrated database retrieval system