KEGG   Homo sapiens (human): 966Help
Entry
966               CDS       T01001                                 

Gene name
CD59, 16.3A5, 1F5, EJ16, EJ30, EL32, G344, HRF-20, HRF20, MAC-IP, MACIF, MEM43, MIC11, MIN1, MIN2, MIN3, MIRL, MSK21, p18-20
Definition
CD59 molecule, complement regulatory protein
Orthology
K04008  
CD59 antigen
Organism
hsa  Homo sapiens (human)
Pathway
Complement and coagulation cascades
Hematopoietic cell lineage
Disease
H00106  
Complement regulatory protein defects
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    966 (CD59)
   04610 Complement and coagulation cascades
    966 (CD59)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   966 (CD59)
  Exosomal proteins of other body fluids (saliva and urine)
   966 (CD59)
  Exosomal proteins of colorectal cancer cells
   966 (CD59)
Cellular antigens [BR:hsa04090]
 Proteins
  966 (CD59)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
11p13
AA seq 128 aa AA seqDB search
MGIQGGSVLFGLLLVLAVFCHSGHSLQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQV
YNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLENGGTSLSEKTVLLLVTPFL
AAAWSLHP
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgggaatccaaggagggtctgtcctgttcgggctgctgctcgtcctggctgtcttctgc
cattcaggtcatagcctgcagtgctacaactgtcctaacccaactgctgactgcaaaaca
gccgtcaattgttcatctgattttgatgcgtgtctcattaccaaagctgggttacaagtg
tataacaagtgttggaagtttgagcattgcaatttcaacgacgtcacaacccgcttgagg
gaaaatgagctaacgtactactgctgcaagaaggacctgtgtaactttaacgaacagctt
gaaaatggtgggacatccttatcagagaaaacagttcttctgctggtgactccatttctg
gcagcagcctggagccttcatccctaa

DBGET integrated database retrieval system