KEGG   Homo sapiens (human): 972Help
Entry
972               CDS       T01001                                 

Gene name
CD74, DHLAG, HLADG, II, Ia-GAMMA
Definition
CD74 molecule, major histocompatibility complex, class II invariant chain
Orthology
K06505  
CD74 antigen
Organism
hsa  Homo sapiens (human)
Pathway
Antigen processing and presentation
Tuberculosis
Herpes simplex infection
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04612 Antigen processing and presentation
    972 (CD74)
 Human Diseases
  Infectious diseases
   05152 Tuberculosis
    972 (CD74)
   05168 Herpes simplex infection
    972 (CD74)
Cellular antigens [BR:hsa04090]
 Proteins
  972 (CD74)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
5q32
AA seq 160 aa AA seqDB search
MHRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGALYTGFSILVTLL
LAGQATTAYFLYQQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPM
GALPQGPMQNATKYGNMTEDHVMHLLQSHWNWRTRLLGWV
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgcacaggaggagaagcaggagctgtcgggaagatcagaagccagtcatggatgaccag
cgcgaccttatctccaacaatgagcaactgcccatgctgggccggcgccctggggccccg
gagagcaagtgcagccgcggagccctgtacacaggcttttccatcctggtgactctgctc
ctcgctggccaggccaccaccgcctacttcctgtaccagcagcagggccggctggacaaa
ctgacagtcacctcccagaacctgcagctggagaacctgcgcatgaagcttcccaagcct
cccaagcctgtgagcaagatgcgcatggccaccccgctgctgatgcaggcgctgcccatg
ggagccctgccccaggggcccatgcagaatgccaccaagtatggcaacatgacagaggac
catgtgatgcacctgctccagagtcactggaactggaggacccgtcttctgggctgggtg
tga

DBGET integrated database retrieval system