KEGG   Homo sapiens (human): 972Help
Entry
972               CDS       T01001                                 

Gene name
CD74, DHLAG, HLADG, II, Ia-GAMMA
Definition
(RefSeq) CD74 molecule
  KO
K06505  
CD74 antigen
Organism
hsa  Homo sapiens (human)
Pathway
Antigen processing and presentation
Tuberculosis
Herpes simplex infection
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04612 Antigen processing and presentation
    972 (CD74)
 Human Diseases
  Infectious diseases
   05152 Tuberculosis
    972 (CD74)
   05168 Herpes simplex infection
    972 (CD74)
Cellular antigens [BR:hsa04090]
 Proteins
  972 (CD74)
Proteoglycans [BR:hsa00535]
 Cell surface proteoglycans
  Others
   972 (CD74)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
5q32
AA seq 296 aa AA seqDB search
MHRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGALYTGFSILVTLL
LAGQATTAYFLYQQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPM
GALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKV
FESWMHHWLLFEMSRHSLEQKPTDAPPKVLTKCQEEVSHIPAVHPGSFRPKCDENGNYLP
LQCYGSIGYCWCVFPNGTEVPNTRSRGHHNCSESLELEDPSSGLGVTKQDLGPVPM
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgcacaggaggagaagcaggagctgtcgggaagatcagaagccagtcatggatgaccag
cgcgaccttatctccaacaatgagcaactgcccatgctgggccggcgccctggggccccg
gagagcaagtgcagccgcggagccctgtacacaggcttttccatcctggtgactctgctc
ctcgctggccaggccaccaccgcctacttcctgtaccagcagcagggccggctggacaaa
ctgacagtcacctcccagaacctgcagctggagaacctgcgcatgaagcttcccaagcct
cccaagcctgtgagcaagatgcgcatggccaccccgctgctgatgcaggcgctgcccatg
ggagccctgccccaggggcccatgcagaatgccaccaagtatggcaacatgacagaggac
catgtgatgcacctgctccagaatgctgaccccctgaaggtgtacccgccactgaagggg
agcttcccggagaacctgagacaccttaagaacaccatggagaccatagactggaaggtc
tttgagagctggatgcaccattggctcctgtttgaaatgagcaggcactccttggagcaa
aagcccactgacgctccaccgaaagtactgaccaagtgccaggaagaggtcagccacatc
cctgctgtccacccgggttcattcaggcccaagtgcgacgagaacggcaactatctgcca
ctccagtgctatgggagcatcggctactgctggtgtgtcttccccaacggcacggaggtc
cccaacaccagaagccgcgggcaccataactgcagtgagtcactggaactggaggacccg
tcttctgggctgggtgtgaccaagcaggatctgggcccagtccccatgtga

DBGET integrated database retrieval system