KEGG   Homo sapiens (human): 974Help
Entry
974               CDS       T01001                                 

Gene name
CD79B, AGM6, B29, IGB
Definition
(RefSeq) CD79b molecule
  KO
K06507  CD79B antigen
Organism
hsa  Homo sapiens (human)
Pathway
hsa04662  B cell receptor signaling pathway
Disease
H00085  Agammaglobulinemias
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04662 B cell receptor signaling pathway
    974 (CD79B)
CD molecules [BR:hsa04090]
 Proteins
  974 (CD79B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: V-set I-set Ig_3 ig ITAM Ig_2 Sigma_reg_N Ig_4 Adeno_E3_CR1
Motif
Other DBs
NCBI-GeneID: 974
NCBI-ProteinID: NP_000617
OMIM: 147245
HGNC: 1699
Ensembl: ENSG00000007312
Vega: OTTHUMG00000172294
Pharos: P40259(Tbio)
UniProt: P40259
Structure
PDB: 

Jmol
Position
17q23.3
AA seq 229 aa AA seqDB search
MARLALSPVPSHWMVALLLLLSAEPVPAARSEDRYRNPKGSACSRIWQSPRFIARKRGFT
VKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIY
FCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKDGIIMIQTLLIILFIIVPIFLL
LDKDDSKAGMEEDHTYEGLDIDQTATYEDIVTLRTGEVKWSVGEHPGQE
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atggccaggctggcgttgtctcctgtgcccagccactggatggtggcgttgctgctgctg
ctctcagctgagccagtaccagcagccagatcggaggaccggtaccggaatcccaaaggt
agtgcttgttcgcggatctggcagagcccacgtttcatagccaggaaacggggcttcacg
gtgaaaatgcactgctacatgaacagcgcctccggcaatgtgagctggctctggaagcag
gagatggacgagaatccccagcagctgaagctggaaaagggccgcatggaagagtcccag
aacgaatctctcgccaccctcaccatccaaggcatccggtttgaggacaatggcatctac
ttctgtcagcagaagtgcaacaacacctcggaggtctaccagggctgcggcacagagctg
cgagtcatgggattcagcaccttggcacagctgaagcagaggaacacgctgaaggatggt
atcatcatgatccagacgctgctgatcatcctcttcatcatcgtgcctatcttcctgctg
ctggacaaggatgacagcaaggctggcatggaggaagatcacacctacgagggcctggac
attgaccagacagccacctatgaggacatagtgacgctgcggacaggggaagtgaagtgg
tctgtaggtgagcacccaggccaggagtga

DBGET integrated database retrieval system