KEGG   Homo sapiens (human): 974Help
Entry
974               CDS       T01001                                 

Gene name
CD79B, AGM6, B29, IGB
Definition
(RefSeq) CD79b molecule
  KO
K06507  
CD79B antigen
Organism
hsa  Homo sapiens (human)
Pathway
B cell receptor signaling pathway
Disease
H00085  
Agammaglobulinemias
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04662 B cell receptor signaling pathway
    974 (CD79B)
Cellular antigens [BR:hsa04090]
 Proteins
  974 (CD79B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17q23
AA seq 229 aa AA seqDB search
MARLALSPVPSHWMVALLLLLSAEPVPAARSEDRYRNPKGSACSRIWQSPRFIARKRGFT
VKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIY
FCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKDGIIMIQTLLIILFIIVPIFLL
LDKDDSKAGMEEDHTYEGLDIDQTATYEDIVTLRTGEVKWSVGEHPGQE
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atggccaggctggcgttgtctcctgtgcccagccactggatggtggcgttgctgctgctg
ctctcagctgagccagtaccagcagccagatcggaggaccggtaccggaatcccaaaggt
agtgcttgttcgcggatctggcagagcccacgtttcatagccaggaaacggggcttcacg
gtgaaaatgcactgctacatgaacagcgcctccggcaatgtgagctggctctggaagcag
gagatggacgagaatccccagcagctgaagctggaaaagggccgcatggaagagtcccag
aacgaatctctcgccaccctcaccatccaaggcatccggtttgaggacaatggcatctac
ttctgtcagcagaagtgcaacaacacctcggaggtctaccagggctgcggcacagagctg
cgagtcatgggattcagcaccttggcacagctgaagcagaggaacacgctgaaggatggt
atcatcatgatccagacgctgctgatcatcctcttcatcatcgtgcctatcttcctgctg
ctggacaaggatgacagcaaggctggcatggaggaagatcacacctacgagggcctggac
attgaccagacagccacctatgaggacatagtgacgctgcggacaggggaagtgaagtgg
tctgtaggtgagcacccaggccaggagtga

DBGET integrated database retrieval system