KEGG   Homo sapiens (human): 9759Help
Entry
9759              CDS       T01001                                 

Gene name
HDAC4, AHO3, BDMR, HA6116, HD4, HDAC-4, HDAC-A, HDACA
Definition
(RefSeq) histone deacetylase 4
  KO
K11406  
histone deacetylase 4/5 [EC:3.5.1.98]
Organism
hsa  Homo sapiens (human)
Pathway
Apelin signaling pathway
Alcoholism
Epstein-Barr virus infection
Viral carcinogenesis
MicroRNAs in cancer
Disease
H00561  
Brachydacytly-mental retardation syndrome and Smith-Magenis syndrome
Drug target
Abexinostat (DG01402): 
Belinostat: 
Panobinostat (DG01403): 
Quisinostat (DG01407): 
Romidepsin: 
Valproic acid (DG00849): 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    9759 (HDAC4)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    9759 (HDAC4)
   05203 Viral carcinogenesis
    9759 (HDAC4)
  Substance dependence
   05034 Alcoholism
    9759 (HDAC4)
  Infectious diseases
   05169 Epstein-Barr virus infection
    9759 (HDAC4)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     9759 (HDAC4)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     9759 (HDAC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P56524(Tclin)
UniProt: 
Structure
PDB: 

Jmol
Position
2q37.3
AA seq 1084 aa AA seqDB search
MSSQSHPDGLSGRDQPVELLNPARVNHMPSTVDVATALPLQVAPSAVPMDLRLDHQFSLP
VAEPALREQQLQQELLALKQKQQIQRQILIAEFQRQHEQLSRQHEAQLHEHIKQQQEMLA
MKHQQELLEHQRKLERHRQEQELEKQHREQKLQQLKNKEKGKESAVASTEVKMKLQEFVL
NKKKALAHRNLNHCISSDPRYWYGKTQHSSLDQSSPPQSGVSTSYNHPVLGMYDAKDDFP
LRKTASEPNLKLRSRLKQKVAERRSSPLLRRKDGPVVTALKKRPLDVTDSACSSAPGSGP
SSPNNSSGSVSAENGIAPAVPSIPAETSLAHRLVAREGSAAPLPLYTSPSLPNITLGLPA
TGPSAGTAGQQDAERLTLPALQQRLSLFPGTHLTPYLSTSPLERDGGAAHSPLLQHMVLL
EQPPAQAPLVTGLGALPLHAQSLVGADRVSPSIHKLRQHRPLGRTQSAPLPQNAQALQHL
VIQQQHQQFLEKHKQQFQQQQLQMNKIIPKPSEPARQPESHPEETEEELREHQALLDEPY
LDRLPGQKEAHAQAGVQVKQEPIESDEEEAEPPREVEPGQRQPSEQELLFRQQALLLEQQ
RIHQLRNYQASMEAAGIPVSFGGHRPLSRAQSSPASATFPVSVQEPPTKPRFTTGLVYDT
LMLKHQCTCGSSSSHPEHAGRIQSIWSRLQETGLRGKCECIRGRKATLEELQTVHSEAHT
LLYGTNPLNRQKLDSKKLLGSLASVFVRLPCGGVGVDSDTIWNEVHSAGAARLAVGCVVE
LVFKVATGELKNGFAVVRPPGHHAEESTPMGFCYFNSVAVAAKLLQQRLSVSKILIVDWD
VHHGNGTQQAFYSDPSVLYMSLHRYDDGNFFPGSGAPDEVGTGPGVGFNVNMAFTGGLDP
PMGDAEYLAAFRTVVMPIASEFAPDVVLVSSGFDAVEGHPTPLGGYNLSARCFGYLTKQL
MGLAGGRIVLALEGGHDLTAICDASEACVSALLGNELDPLPEKVLQQRPNANAVRSMEKV
MEIHSKYWRCLQRTTSTAGRSLIEAQTCENEEAETVTAMASLSVGVKPAEKRPDEEPMEE
EPPL
NT seq 3255 nt NT seq  +upstreamnt  +downstreamnt
atgagctcccaaagccatccagatggactttctggccgagaccagccagtggagctgctg
aatcctgcccgcgtgaaccacatgcccagcacggtggatgtggccacggcgctgcctctg
caagtggccccctcggcagtgcccatggacctgcgcctggaccaccagttctcactgcct
gtggcagagccggccctgcgggagcagcagctgcagcaggagctcctggcgctcaagcag
aagcagcagatccagaggcagatcctcatcgctgagttccagaggcagcacgagcagctc
tcccggcagcacgaggcgcagctccacgagcacatcaagcaacaacaggagatgctggcc
atgaagcaccagcaggagctgctggaacaccagcggaagctggagaggcaccgccaggag
caggagctggagaagcagcaccgggagcagaagctgcagcagctcaagaacaaggagaag
ggcaaagagagtgccgtggccagcacagaagtgaagatgaagttacaagaatttgtcctc
aataaaaagaaggcgctggcccaccggaatctgaaccactgcatttccagcgaccctcgc
tactggtacgggaaaacgcagcacagttcccttgaccagagttctccaccccagagcgga
gtgtcgacctcctataaccacccggtcctgggaatgtacgacgccaaagatgacttccct
cttaggaaaacagcttctgaaccgaatctgaaattacggtccaggctaaagcagaaagtg
gccgaaagacggagcagccccctgttacgcaggaaagacgggccagtggtcactgctcta
aaaaagcgtccgttggatgtcacagactccgcgtgcagcagcgccccaggctccggaccc
agctcacccaacaacagctccgggagcgtcagcgcggagaacggtatcgcgcccgccgtc
cccagcatcccggcggagacgagtttggcgcacagacttgtggcacgagaaggctcggcc
gctccacttcccctctacacatcgccatccttgcccaacatcacgctgggcctgcctgcc
accggcccctctgcgggcacggcgggccagcaggacgccgagagactcacccttcccgcc
ctccagcagaggctctcccttttccccggcacccacctcactccctacctgagcacctcg
cccttggagcgggacggaggggcagcgcacagccctcttctgcagcacatggtcttactg
gagcagccgccggcacaagcacccctcgtcacaggcctgggagcactgcccctccacgca
cagtccttggttggtgcagaccgggtgtccccctccatccacaagctgcggcagcaccgc
ccactggggcggacccagtcggccccgctgccccagaacgcccaggctctgcagcacctg
gtcatccagcagcagcatcagcagtttctggagaaacacaagcagcagttccagcagcag
caactgcagatgaacaagatcatccccaagccaagcgagccagcccggcagccggagagc
cacccggaggagacggaggaggagctccgtgagcaccaggctctgctggacgagccctac
ctggaccggctgccggggcagaaggaggcgcacgcacaggccggcgtgcaggtgaagcag
gagcccattgagagcgatgaggaagaggcagagcccccacgggaggtggagccgggccag
cgccagcccagtgagcaggagctgctcttcagacagcaagccctcctgctggagcagcag
cggatccaccagctgaggaactaccaggcgtccatggaggccgccggcatccccgtgtcc
ttcggcggccacaggcctctgtcccgggcgcagtcctcacccgcgtctgccaccttcccc
gtgtctgtgcaggagccccccaccaagccgaggttcacgacaggcctcgtgtatgacacg
ctgatgctgaagcaccagtgcacctgcgggagtagcagcagccaccccgagcacgccggg
aggatccagagcatctggtcccgcctgcaggagacgggcctccggggcaaatgcgagtgc
atccgcggacgcaaggccaccctggaggagctacagacggtgcactcggaagcccacacc
ctcctgtatggcacgaaccccctcaaccggcagaaactggacagtaagaaacttctaggc
tcgctcgcctccgtgttcgtccggctcccttgcggtggtgttggggtggacagtgacacc
atatggaacgaggtgcactcggcgggggcagcccgcctggctgtgggctgcgtggtagag
ctggtcttcaaggtggccacaggggagctgaagaatggctttgctgtggtccgcccccct
ggacaccatgcggaggagagcacgcccatgggcttttgctacttcaactccgtggccgtg
gcagccaagcttctgcagcagaggttgagcgtgagcaagatcctcatcgtggactgggac
gtgcaccatggaaacgggacccagcaggctttctacagcgaccccagcgtcctgtacatg
tccctccaccgctacgacgatgggaacttcttcccaggcagcggggctcctgatgaggtg
ggcacagggcccggcgtgggtttcaacgtcaacatggctttcaccggcggcctggacccc
cccatgggagacgctgagtacttggcggccttcagaacggtggtcatgccgatcgccagc
gagtttgccccggatgtggtgctggtgtcatcaggcttcgatgccgtggagggccacccc
acccctcttgggggctacaacctctccgccagatgcttcgggtacctgacgaagcagctg
atgggcctggctggcggccggattgtcctggccctcgagggaggccacgacctgaccgcc
atttgcgacgcctcggaagcatgtgtttctgccttgctgggaaacgagcttgatcctctc
ccagaaaaggttttacagcaaagacccaatgcaaacgctgtccgttccatggagaaagtc
atggagatccacagcaagtactggcgctgcctgcagcgcacaacctccacagcggggcgt
tctctgatcgaggctcagacttgcgagaacgaagaagccgagacggtcaccgccatggcc
tcgctgtccgtgggcgtgaagcccgccgaaaagagaccagatgaggagcccatggaagag
gagccgcccctgtag

DBGET integrated database retrieval system