KEGG   Homo sapiens (human): 983Help
Entry
983               CDS       T01001                                 

Gene name
CDK1, CDC2, CDC28A, P34CDC2
Definition
cyclin-dependent kinase 1 (EC:2.7.11.23 2.7.11.22)
Orthology
K02087  
cyclin-dependent kinase 1 [EC:2.7.11.22 2.7.11.23]
Organism
hsa  Homo sapiens (human)
Pathway
Cell cycle
Oocyte meiosis
p53 signaling pathway
Gap junction
Progesterone-mediated oocyte maturation
Herpes simplex infection
Epstein-Barr virus infection
Viral carcinogenesis
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    983 (CDK1)
   04114 Oocyte meiosis
    983 (CDK1)
   04115 p53 signaling pathway
    983 (CDK1)
  Cell communication
   04540 Gap junction
    983 (CDK1)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    983 (CDK1)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    983 (CDK1)
  Infectious diseases
   05168 Herpes simplex infection
    983 (CDK1)
   05169 Epstein-Barr virus infection
    983 (CDK1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     983 (CDK1)
    2.7.11.23  [RNA-polymerase]-subunit kinase
     983 (CDK1)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: CMGC group
  CDK family
   983 (CDK1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   983 (CDK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
10q21.1
AA seq 109 aa AA seqDB search
MEDYTKIEKIGEGTYGVVYKGRHKTTGQVVAMKKIRLESEEEGVPSTAIREISLLKELRH
PNIVSLQDVLMQDSRLYLIFEFLSMDLKKYLDSIPPGQYMDSSLVKVKA
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atggaagattataccaaaatagagaaaattggagaaggtacctatggagttgtgtataag
ggtagacacaaaactacaggtcaagtggtagccatgaaaaaaatcagactagaaagtgaa
gaggaaggggttcctagtactgcaattcgggaaatttctctattaaaggaacttcgtcat
ccaaatatagtcagtcttcaggatgtgcttatgcaggattccaggttatatctcatcttt
gagtttctttccatggatctgaagaaatacttggattctatccctcctggtcagtacatg
gattcttcacttgttaaggtaaaagcttaa

DBGET integrated database retrieval system