KEGG   Homo sapiens (human): 9844Help
Entry
9844              CDS       T01001                                 

Gene name
ELMO1, CED-12, CED12, ELMO-1
Definition
(RefSeq) engulfment and cell motility 1
  KO
K12366  
engulfment and cell motility protein 1
Organism
hsa  Homo sapiens (human)
Pathway
Chemokine signaling pathway
Bacterial invasion of epithelial cells
Shigellosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04062 Chemokine signaling pathway
    9844 (ELMO1)
 Human Diseases
  Infectious diseases
   05131 Shigellosis
    9844 (ELMO1)
   05100 Bacterial invasion of epithelial cells
    9844 (ELMO1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
7p14.1
AA seq 727 aa AA seqDB search
MPPPADIVKVAIEWPGAYPKLMEIDQKKPLSAIIKEVCDGWSLANHEYFALQHADSSNFY
ITEKNRNEIKNGTILRLTTSPAQNAQQLHERIQSSSMDAKLEALKDLASLSRDVTFAQEF
INLDGISLLTQMVESGTERYQKLQKIMKPCFGDMLSFTLTAFVELMDHGIVSWDTFSVAF
IKKIASFVNKSAIDISILQRSLAILESMVLNSHDLYQKVAQEITIGQLIPHLQGSDQEIQ
TYTIAVINALFLKAPDERRQEMANILAQKQLRSIILTHVIRAQRAINNEMAHQLYVLQVL
TFNLLEDRMMTKMDPQDQAQRDIIFELRRIAFDAESEPNNSSGSMEKRKSMYTRDYKKLG
FINHVNPAMDFTQTPPGMLALDNMLYFAKHHQDAYIRIVLENSSREDKHECPFGRSSIEL
TKMLCEILKVGELPSETCNDFHPMFFTHDRSFEEFFCICIQLLNKTWKEMRATSEDFNKV
MQVVKEQVMRALTTKPSSLDQFKSKLQNLSYTEILKIRQSERMNQEDFQSRPILELKEKI
QPEILELIKQQRLNRLVEGTCFRKLNARRRQDKFWYCRLSPNHKVLHYGDLEESPQGEVP
HDSLQDKLPVADIKAVVTGKDCPHMKEKGALKQNKEVLELAFSILYDSNCQLNFIAPDKH
EYCIWTDGLNALLGKDMMSDLTRNDLDTLLSMEIKLRLLDLENIQIPDAPPPIPKEPSNY
DFVYDCN
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgccgccacccgcggacatcgtcaaggtggccatagaatggccgggcgcctaccccaaa
ctcatggaaattgatcagaaaaaaccactgtctgcaataataaaggaagtctgtgatggg
tggtctcttgccaaccatgaatattttgcactccagcatgccgatagttcaaacttctat
atcacagaaaagaaccgcaatgagataaaaaatggcactatccttcgattaaccacatct
ccagctcagaacgcccagcagctccatgaacgaatccagtcctcgagtatggatgccaag
ctggaagccctgaaggacttggccagcctctcccgggatgtcacgtttgcccaggagttt
ataaacctggacggtatctctctcctcacgcagatggtggagagcggcactgagcgatac
cagaaattgcagaagatcatgaagccttgctttggagacatgctgtccttcaccctgacg
gccttcgttgagctgatggaccatggcatagtgtcctgggatacattttcggtggcgttc
attaagaagatagcaagttttgtgaacaagtcagccatagacatctcgatcctgcagcgg
tccttggccattttggagtcgatggtgctcaatagccatgacctctaccagaaagtggcg
caggagatcaccatcggccagctcattccacacctgcaagggtcagatcaagaaatccaa
acctatactattgcagtgattaatgcgcttttcctgaaggctcctgatgagaggaggcag
gagatggcgaatattttggctcagaagcaactgcgttccatcattttaacacatgtcatc
cgagcccagcgggccatcaacaatgagatggcgcaccagctgtatgttctacaagtgctc
acctttaacctcctggaagacaggatgatgaccaaaatggacccccaggaccaggctcag
agggacatcatatttgaacttcgaagaattgcttttgatgctgagtctgaacctaacaac
agcagtggcagcatggagaaacgcaagtccatgtacacgcgagattataagaagcttggg
ttcattaatcatgtcaaccctgccatggacttcacgcagactccacctgggatgttggct
ctggacaacatgctgtactttgccaagcaccaccaagatgcctacatccggattgtgctt
gagaacagtagtcgagaagacaagcatgaatgtccctttggccgcagtagtatagagctg
accaagatgctatgtgagatcttgaaagtgggcgagttgcctagtgagacctgcaacgac
ttccacccgatgttcttcacccacgacagatcctttgaggagtttttctgcatctgtatc
cagctcctgaacaagacatggaaggaaatgagggcaacttctgaagacttcaacaaggta
atgcaggtggtgaaggagcaggttatgagagcacttacaaccaagcctagctccctggac
cagttcaagagcaaactgcagaacctgagctacactgagatcctgaaaatccgccagtcc
gagaggatgaaccaggaagatttccagtcccgcccgattttggaactaaaggagaagatt
cagccagaaatcttagagctgatcaaacagcaacgcctgaaccgccttgtggaagggacc
tgctttaggaaactcaatgcccggcggaggcaagacaagttttggtattgtcggctttcg
ccaaatcacaaagtcctgcattacggagacttagaagagagtcctcagggagaagtgccc
cacgattccttgcaggacaaactgccggtggcagatatcaaagccgtggtgacgggaaag
gactgccctcatatgaaagagaaaggtgcccttaaacaaaacaaggaggtgcttgaactc
gctttctccatcttgtatgactcaaactgccaactgaacttcatcgctcctgacaagcat
gagtactgtatctggacggatggactgaatgcgctactcgggaaggacatgatgagcgac
ctgacgcggaatgacctggacaccctgctcagcatggaaatcaagctccgcctcctggac
ctggaaaacatccagatccctgacgcacctccgccgattcccaaggagcccagcaactat
gacttcgtctatgactgtaactga

DBGET integrated database retrieval system