KEGG   Homo sapiens (human): 9844Help
Entry
9844              CDS       T01001                                 

Gene name
ELMO1, CED-12, CED12, ELMO-1
Definition
engulfment and cell motility 1
Orthology
K12366  
engulfment and cell motility protein 1
Organism
hsa  Homo sapiens (human)
Pathway
Chemokine signaling pathway
Bacterial invasion of epithelial cells
Shigellosis
Class
Organismal Systems; Immune system; Chemokine signaling pathway [PATH:hsa04062]
Human Diseases; Infectious diseases; Shigellosis [PATH:hsa05131]
Human Diseases; Infectious diseases; Bacterial invasion of epithelial cells [PATH:hsa05100]
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
7p14.1
AA seq 247 aa AA seqDB search
MQVVKEQVMRALTTKPSSLDQFKSKLQNLSYTEILKIRQSERMNQEDFQSRPILELKEKI
QPEILELIKQQRLNRLVEGTCFRKLNARRRQDKFWYCRLSPNHKVLHYGDLEESPQGEVP
HDSLQDKLPVADIKAVVTGKDCPHMKEKGALKQNKEVLELAFSILYDSNCQLNFIAPDKH
EYCIWTDGLNALLGKDMMSDLTRNDLDTLLSMEIKLRLLDLENIQIPDAPPPIPKEPSNY
DFVYDCN
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtggtgaaggagcaggttatgagagcacttacaaccaagcctagctccctggac
cagttcaagagcaaactgcagaacctgagctacactgagatcctgaaaatccgccagtcc
gagaggatgaaccaggaagatttccagtcccgcccgattttggaactaaaggagaagatt
cagccagaaatcttagagctgatcaaacagcaacgcctgaaccgccttgtggaagggacc
tgctttaggaaactcaatgcccggcggaggcaagacaagttttggtattgtcggctttcg
ccaaatcacaaagtcctgcattacggagacttagaagagagtcctcagggagaagtgccc
cacgattccttgcaggacaaactgccggtggcagatatcaaagccgtggtgacgggaaag
gactgccctcatatgaaagagaaaggtgcccttaaacaaaacaaggaggtgcttgaactc
gctttctccatcttgtatgactcaaactgccaactgaacttcatcgctcctgacaagcat
gagtactgtatctggacggatggactgaatgcgctactcgggaaggacatgatgagcgac
ctgacgcggaatgacctggacaccctgctcagcatggaaatcaagctccgcctcctggac
ctggaaaacatccagatccctgacgcacctccgccgattcccaaggagcccagcaactat
gacttcgtctatgactgtaactga

DBGET integrated database retrieval system