KEGG   Homo sapiens (human): 990Help
Entry
990               CDS       T01001                                 

Gene name
CDC6, CDC18L, HsCDC18, HsCDC6
Definition
(RefSeq) cell division cycle 6
  KO
K02213  
cell division control protein 6
Organism
hsa  Homo sapiens (human)
Pathway
Cell cycle
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    990 (CDC6)
DNA replication proteins [BR:hsa03032]
 Eukaryotic Type
  DNA Replication Initiation Factors
   pre-RC (pre-replication complex)
    990 (CDC6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
17q21.3
AA seq 560 aa AA seqDB search
MPQTRSQAQATISFPKRKLSRALNKAKNSSDAKLEPTNVQTVTCSPRVKALPLSPRKRLG
DDNLCNTPHLPPCSPPKQGKKENGPPHSHTLKGRRLVFDNQLTIKSPSKRELAKVHQNKI
LSSVRKSQEITTNSEQRCPLKKESACVRLFKQEGTCYQQAKLVLNTAVPDRLPAREREMD
VIRNFLREHICGKKAGSLYLSGAPGTGKTACLSRILQDLKKELKGFKTIMLNCMSLRTAQ
AVFPAIAQEICQEEVSRPAGKDMMRKLEKHMTAEKGPMIVLVLDEMDQLDSKGQDVLYTL
FEWPWLSNSHLVLIGIANTLDLTDRILPRLQAREKCKPQLLNFPPYTRNQIVTILQDRLN
QVSRDQVLDNAAVQFCARKVSAVSGDVRKALDVCRRAIEIVESDVKSQTILKPLSECKSP
SEPLIPKRVGLIHISQVISEVDGNRMTLSQEGAQDSFPLQQKILVCSLMLLIRQLKIKEV
TLGKLYEAYSKVCRKQQVAAVDQSECLSLSGLLEARGILGLKRNKETRLTKVFFKIEEKE
IEHALKDKALIGNILATGLP
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgcctcaaacccgatcccaggcacaggctacaatcagttttccaaaaaggaagctgtct
cgggcattgaacaaagctaaaaactccagtgatgccaaactagaaccaacaaatgtccaa
accgtaacctgttctcctcgtgtaaaagccctgcctctcagccccaggaaacgtctgggc
gatgacaacctatgcaacactccccatttacctccttgttctccaccaaagcaaggcaag
aaagagaatggtccccctcactcacatacacttaagggacgaagattggtatttgacaat
cagctgacaattaagtctcctagcaaaagagaactagccaaagttcaccaaaacaaaata
ctttcttcagttagaaaaagtcaagagatcacaacaaattctgagcagagatgtccactg
aagaaagaatctgcatgtgtgagactattcaagcaagaaggcacttgctaccagcaagca
aagctggtcctgaacacagctgtcccagatcggctgcctgccagggaaagggagatggat
gtcatcaggaatttcttgagggaacacatctgtgggaaaaaagctggaagcctttacctt
tctggtgctcctggaactggaaaaactgcctgcttaagccggattctgcaagacctcaag
aaggaactgaaaggctttaaaactatcatgctgaattgcatgtccttgaggactgcccag
gctgtattcccagctattgctcaggagatttgtcaggaagaggtatccaggccagctggg
aaggacatgatgaggaaattggaaaaacatatgactgcagagaagggccccatgattgtg
ttggtattggacgagatggatcaactggacagcaaaggccaggatgtattgtacacgcta
tttgaatggccatggctaagcaattctcacttggtgctgattggtattgctaataccctg
gatctcacagatagaattctacctaggcttcaagctagagaaaaatgtaagccacagctg
ttgaacttcccaccttataccagaaatcagatagtcactattttgcaagatcgacttaat
caggtatctagagatcaggttctggacaatgctgcagttcaattctgtgcccgcaaagtc
tctgctgtttcaggagatgttcgcaaagcactggatgtttgcaggagagctattgaaatt
gtagagtcagatgtcaaaagccagactattctcaaaccactgtctgaatgtaaatcacct
tctgagcctctgattcccaagagggttggtcttattcacatatcccaagtcatctcagaa
gttgatggtaacaggatgaccttgagccaagaaggagcacaagattccttccctcttcag
cagaagatcttggtttgctctttgatgctcttgatcaggcagttgaaaatcaaagaggtc
actctggggaagttatatgaagcctacagtaaagtctgtcgcaaacagcaggtggcggct
gtggaccagtcagagtgtttgtcactttcagggctcttggaagccaggggcattttagga
ttaaagagaaacaaggaaacccgtttgacaaaggtgtttttcaagattgaagagaaagaa
atagaacatgctctgaaagataaagctttaattggaaatatcttagctactggattgcct
taa

DBGET integrated database retrieval system