KEGG   Homo sapiens (human): 991Help
Entry
991               CDS       T01001                                 

Gene name
CDC20, CDC20A, bA276H19.3, p55CDC
Definition
cell division cycle 20
Orthology
K03363  
cell division cycle 20, cofactor of APC complex
Organism
hsa  Homo sapiens (human)
Pathway
Cell cycle
Oocyte meiosis
Ubiquitin mediated proteolysis
HTLV-I infection
Viral carcinogenesis
Module
APC/C complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    991 (CDC20)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    991 (CDC20)
   04114 Oocyte meiosis
    991 (CDC20)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    991 (CDC20)
  Infectious diseases
   05166 HTLV-I infection
    991 (CDC20)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    target recognizing subunit
     991 (CDC20)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p34.1
AA seq 499 aa AA seqDB search
MAQFAFESDLHSLLQLDAPIPNAPPARWQRKAKEAAGPAPSPMRAANRSHSAGRTPGRTP
GKSSSKVQTTPSKPGGDRYIPHRSAAQMEVASFLLSKENQPENSQTPTKKEHQKAWALNL
NGFDVEEAKILRLSGKPQNAPEGYQNRLKVLYSQKATPGSSRKTCRYIPSLPDRILDAPE
IRNDYYLNLVDWSSGNVLAVALDNSVYLWSASSGDILQLLQMEQPGEYISSVAWIKEGNY
LAVGTSSAEVQLWDVQQQKRLRNMTSHSARVGSLSWNSYILSSGSRSGHIHHHDVRVAEH
HVATLSGHSQEVCGLRWAPDGRHLASGGNDNLVNVWPSAPGEGGWVPLQTFTQHQGAVKA
VAWCPWQSNVLATGGGTSDRHIRIWNVCSGACLSAVDAHSQVCSILWSPHYKELISGHGF
AQNQLVIWKYPTMAKVAELKGHTSRVLSLTMSPDGATVASAAADETLRLWRCFELDPARR
REREKASAAKSSLIHQGIR
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atggcacagttcgcgttcgagagtgacctgcactcgctgcttcagctggatgcacccatc
cccaatgcaccccctgcgcgctggcagcgcaaagccaaggaagccgcaggcccggccccc
tcacccatgcgggccgccaaccgatcccacagcgccggcaggactccgggccgaactcct
ggcaaatccagttccaaggttcagaccactcctagcaaacctggcggtgaccgctatatc
ccccatcgcagtgctgcccagatggaggtggccagcttcctcctgagcaaggagaaccag
cctgaaaacagccagacgcccaccaagaaggaacatcagaaagcctgggctttgaacctg
aacggttttgatgtagaggaagccaagatccttcggctcagtggaaaaccacaaaatgcg
ccagagggttatcagaacagactgaaagtactctacagccaaaaggccactcctggctcc
agccggaagacctgccgttacattccttccctgccagaccgtatcctggatgcgcctgaa
atccgaaatgactattacctgaaccttgtggattggagttctgggaatgtactggccgtg
gcactggacaacagtgtgtacctgtggagtgcaagctctggtgacatcctgcagcttttg
caaatggagcagcctggggaatatatatcctctgtggcctggatcaaagagggcaactac
ttggctgtgggcaccagcagtgctgaggtgcagctatgggatgtgcagcagcagaaacgg
cttcgaaatatgaccagtcactctgcccgagtgggctccctaagctggaacagctatatc
ctgtccagtggttcacgttctggccacatccaccaccatgatgttcgggtagcagaacac
catgtggccacactgagtggccacagccaggaagtgtgtgggctgcgctgggccccagat
ggacgacatttggccagtggtggtaatgataacttggtcaatgtgtggcctagtgctcct
ggagagggtggctgggttcctctgcagacattcacccagcatcaaggggctgtcaaggcc
gtagcatggtgtccctggcagtccaatgtcctggcaacaggagggggcaccagtgatcga
cacattcgcatctggaatgtgtgctctggggcctgtctgagtgccgtggatgcccattcc
caggtgtgctccatcctctggtctccccattacaaggagctcatctcaggccatggcttt
gcacagaaccagctagttatttggaagtacccaaccatggccaaggtggctgaactcaaa
ggtcacacatcccgggtcctgagtctgaccatgagcccagatggggccacagtggcatcc
gcagcagcagatgagaccctgaggctatggcgctgttttgagttggaccctgcgcggcgg
cgggagcgggagaaggccagtgcagccaaaagcagcctcatccaccaaggcatccgctga

DBGET integrated database retrieval system