KEGG   Homo sapiens (human): 9915Help
Entry
9915              CDS       T01001                                 

Gene name
ARNT2, bHLHe1
Definition
aryl-hydrocarbon receptor nuclear translocator 2
Orthology
K15589  
aryl hydrocarbon receptor nuclear translocator 2
Organism
hsa  Homo sapiens (human)
Pathway
Pathways in cancer
Transcriptional misregulation in cancer
Renal cell carcinoma
Class
Human Diseases; Cancers; Pathways in cancer [PATH:hsa05200]
Human Diseases; Cancers; Transcriptional misregulation in cancers [PATH:hsa05202]
Human Diseases; Cancers; Renal cell carcinoma [PATH:hsa05211]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Position
15q24
AA seq 717 aa AA seqDB search
MATPAAVNPPEMASDIPGSVTLPVAPMAATGQVRMAGAMPARGGKRRSGMDFDDEDGEGP
SKFSRENHSEIERRRRNKMTQYITELSDMVPTCSALARKPDKLTILRMAVSHMKSMRGTG
NKSTDGAYKPSFLTEQELKHLILEAADGFLFVVAAETGRVIYVSDSVTPVLNQPQSEWFG
STLYEQVHPDDVEKLREQLCTSENSMTGRILDLKTGTVKKEGQQSSMRMCMGSRRSFICR
MRCGNAPLDHLPLNRITTMRKRFRNGLGPVKEGEAQYAVVHCTGYIKAWPPAGMTIPEED
ADVGQGSKYCLVAIGRLQVTSSPVCMDMNGMSVPTEFLSRHNSDGIITFVDPRCISVIGY
QPQDLLGKDILEFCHPEDQSHLRESFQQVVKLKGQVLSVMYRFRTKNREWMLIRTSSFTF
QNPYSDEIEYIICTNTNVKQLQQQQAELEVHQRDGLSSYDLSQVPVPNLPAGVHEAGKSV
EKADAIFSQERDPRFAEMFAGISASEKKMMSSASAAGTQQIYSQGSPFPSGHSGKAFSSS
VVHVPGVNDIQSSSSTGQNMSQISRQLNQSQVAWTGSRPPFPGQQIPSQSSKTQSSPFGI
GTSHTYPADPSSYSPLSSPATSSPSGNAYSSLANRTPGFAESGQSSGQFQGRPSEVWSQW
QSQHHGQQSGEQHSHQQPGQTEVFQDMLPMPGDPTQGTGNYNIEDFADLGMFPPFSE
NT seq 2154 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccccggcggcggtcaaccctccggaaatggcttcagacatacctggatctgtg
acgttgcccgttgcccccatggcggccaccggacaggtgaggatggcgggggccatgcct
gcccgtggaggaaagcggcgttccggaatggacttcgatgatgaagatggtgaaggcccc
agtaaattttcaagagagaatcatagtgaaatcgaaaggcgcagacggaacaagatgact
cagtacatcacggagctctccgacatggtccccacatgcagcgcactggctcggaagcca
gacaagctcaccatcctccgcatggccgtctcgcacatgaagtccatgaggggtacaggg
aacaagtccaccgatggcgcgtacaagccttccttcctcacagagcaggaactgaagcat
ctcatccttgaagcagctgatggatttctgtttgtggtggctgctgagacagggcgagtg
atttatgtgtctgactccgtcacccctgttctgaaccagccccagtcagagtggtttggg
agcacactgtatgaacaggtgcatcctgatgacgtggagaagctgagagagcaactgtgc
acctcagaaaactcaatgacaggccggatcttggacctgaagactgggacggtcaagaaa
gaagggcagcagtcatccatgaggatgtgcatgggctcgcggcggtctttcatctgcagg
atgaggtgtggaaatgctcctttggaccaccttcctctaaacagaataaccaccatgagg
aaaaggttcaggaatggccttggccctgtgaaagaaggagaagcccaatatgctgtggtc
cactgtacaggatacatcaaggcctggccaccagcaggaatgaccatacctgaagaagac
gctgatgtgggacaaggcagtaaatattgcctcgtggcaattgggagactccaggtgacc
agctctcctgtatgcatggacatgaatgggatgtcggtgcccacagagttcttatcccgg
cataactccgatggaatcatcacatttgtggatccaagatgtatcagtgtgattggctac
caaccccaggatcttctgggaaaggacattttggaattctgccaccctgaggatcaaagc
catctgcgtgagagcttccagcaggtggttaagctgaaaggccaagtcctgtcggtcatg
tatcgatttcgcaccaagaaccgggagtggatgttgatccgcaccagcagcttcacattc
cagaatccctattctgatgagattgagtacatcatctgcaccaacaccaacgtcaagcaa
cttcagcaacagcaggcagaattggaagtgcaccagagagatggattgtcatcgtatgac
ttatcccaggtccccgtccccaacctaccagccggtgttcatgaggccgggaagtccgtg
gaaaaggcggatgcaatcttctcccaggaaagagatcctcggtttgctgaaatgtttgca
ggaattagtgcatcggagaagaagatgatgagctcagcctctgcagcaggaacccagcag
atctactcccaaggaagcccatttccctctggacactccgggaaggccttcagctcttca
gtggttcatgtgcctggagtgaatgatattcagtcctcttcttccacgggccagaacatg
tcccaaatctcccggcagctaaaccagagtcaggtggcatggacagggagtcgtccgccc
tttccgggacagcaaatcccatctcagtccagcaagactcagtcatctccctttgggatt
ggaacgagccacacctacccggcagacccctcttcctacagccccctctccagcccagct
acctcctcgccaagtgggaatgcctactccagtcttgccaacaggactccagggttcgct
gaaagtggacaaagtagcgggcagttccaagggcggccctcggaagtctggtcgcagtgg
caaagccagcaccatggccagcagagcggtgagcagcactcccaccagcagcccggtcag
actgaagtgttccaggacatgctgcccatgccaggagatccaacccaggggactggcaac
tataacatcgaagactttgccgacctgggcatgtttccaccgttttctgagtag

DBGET integrated database retrieval system